Dataset for protein E1B 19K of organism Human adenovirus F serotype 41

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F4ZCJ8_E1B19K-01        MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
A0A1S6ELT2_E1B19K-      MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
B5SNR1_E1B19K-01        MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
P10544_E1B19K-01        MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
W0S1G8_E1B19K-01        MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
                        **************************************************

F4ZCJ8_E1B19K-01        FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
A0A1S6ELT2_E1B19K-      FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
B5SNR1_E1B19K-01        FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
P10544_E1B19K-01        FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
W0S1G8_E1B19K-01        FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
                        **************************************************

F4ZCJ8_E1B19K-01        DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREE
A0A1S6ELT2_E1B19K-      DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR-E
B5SNR1_E1B19K-01        DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR-E
P10544_E1B19K-01        DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR--
W0S1G8_E1B19K-01        DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR--
                        ************************************************  

F4ZCJ8_E1B19K-01        EEEEEEEEENLRAGLDPQTEL
A0A1S6ELT2_E1B19K-      EEEEEEERENLRAGLDPQTEL
B5SNR1_E1B19K-01        EEEEEEEEENLRAGLDPQTEL
P10544_E1B19K-01        -EEEEEEEENLRAGLDPQTEL
W0S1G8_E1B19K-01        -EEEEEEEENLRAGLDPQTEL
                         ****** *************

© 1998-2018