Dataset for protein adenoviridae of organism Human adenovirus F serotype 40

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A142G3J2_E1B19K-      MELWSELQSYQNLRRLLELASARTSSCWRILFGSTLANVIYRAKEEYSSR
P10543_E1B19K-01        MELWSELQSYQNLRRLLELASARTSSCWRILFGSTLTNVIYRAKEEYSSR
                        ************************************:*************

A0A142G3J2_E1B19K-      FADLLSHNPGIFASLNLGHHSFFQEIVIRNLDFSSPGRTVSGLAFICFIL
P10543_E1B19K-01        FADLLSHNPGIFASLNLGHHSFFQEIVIRNLDFSSPGRTVSGLAFICFIL
                        **************************************************

A0A142G3J2_E1B19K-      DQWSAQTHLSQGYTLDYMAMALWRTLLRRKRVLGCLPAQRPHGLDPVQEE
P10543_E1B19K-01        DQWSAQTHLSQGYTLDYMAMALWRTLLRRKRVLGCLPAQRPHGLDPVQEE
                        **************************************************

A0A142G3J2_E1B19K-      EEEEENLRAGLDPSTEL
P10543_E1B19K-01        EEEEENLRAGLDPSTEL
                        *****************

© 1998-2018