Dataset for protein E1B 19K of organism Human adenovirus E serotype 4

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2KSG6_E1B19K-01      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q2KSM8_E1B19K-01      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q5GFC8_E1B19K-01      MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQ
P10406_E1B19K-01      MEIWTVLEDFHKTRQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYREQ
Q5GFC7_E1B19K-01      MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQ
Q2KSG6_E1B19K-02      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q2KSM8_E1B19K-02      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
                      **********:**************:****************:****.**

Q2KSG6_E1B19K-01      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q2KSM8_E1B19K-01      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q5GFC8_E1B19K-01      FEDILRECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
P10406_E1B19K-01      FEDILRECPSLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
Q5GFC7_E1B19K-01      FEDILRECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
Q2KSG6_E1B19K-02      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q2KSM8_E1B19K-02      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
                      *:***.***.**************************************::

Q2KSG6_E1B19K-01      DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILS
Q2KSM8_E1B19K-01      DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILS
Q5GFC8_E1B19K-01      DKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILS
P10406_E1B19K-01      DKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR--------
Q5GFC7_E1B19K-01      DKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR--------
Q2KSG6_E1B19K-02      DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAI---CRYSR--------
Q2KSM8_E1B19K-02      DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAIPATCRYSR--------
                      ************************:*********      .         

Q2KSG6_E1B19K-01      LQQISQERQRRQQQQEDQEENPRAGLDPPAEEE-
Q2KSM8_E1B19K-01      LQQISQERQRRQQQQEDQEENPRAGLDPPAEEEE
Q5GFC8_E1B19K-01      L-----------QQQEDQEENPRAGLDPPAEE--
P10406_E1B19K-01      ----------------------------------
Q5GFC7_E1B19K-01      ----------------------------------
Q2KSG6_E1B19K-02      ----------------------------------
Q2KSM8_E1B19K-02      ----------------------------------
                                                        

© 1998-2018