Dataset for protein adenoviridae of organism Human adenovirus D serotype 8

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1P7YYY5_E1B19K-      MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEE
A0A1P7YWR9_E1B19K-      MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEE
A0A1P7YWY2_E1B19K-      MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEE
A0A1P7YXN8_E1B19K-      MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEE
B9A5A7_E1B19K-01        MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEE
A0A1P8C849_E1B19K-      MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEE
                        **************************************************

A0A1P7YYY5_E1B19K-      FENLFADCSGLLDSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLV
A0A1P7YWR9_E1B19K-      FENIFADCSGLLDSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLV
A0A1P7YWY2_E1B19K-      FENIFADCSCLLDSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLV
A0A1P7YXN8_E1B19K-      FENIFADCSCLLDSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLV
B9A5A7_E1B19K-01        FENLFADCSGLLDSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLV
A0A1P8C849_E1B19K-      FENLFADCSGLLDSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLV
                        ***:***** ****************************************

A0A1P7YYY5_E1B19K-      DKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHL
A0A1P7YWR9_E1B19K-      DKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHL
A0A1P7YWY2_E1B19K-      DKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHL
A0A1P7YXN8_E1B19K-      DKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHL
B9A5A7_E1B19K-01        DKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHL
A0A1P8C849_E1B19K-      DKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAALGLLHL
                        ******************************************** *****

A0A1P7YYY5_E1B19K-      HRQTSMLEEEIREAMDKNPRSGLDPPLEEELD
A0A1P7YWR9_E1B19K-      HRQTSMLEEEMREAMDKNPRSGLDPPSEEELD
A0A1P7YWY2_E1B19K-      HRQTSMLEEEMRESMDKNPRSGLDPPSEEELD
A0A1P7YXN8_E1B19K-      HRQTSMLEEEMREAMDKNPRSGLDPPSEEELD
B9A5A7_E1B19K-01        HRQTSMLEEEMREAMDKNPRSGLDPPSEEELD
A0A1P8C849_E1B19K-      HRQTSMLEEEMREAMDKNPRSGLDPPSEEELD
                        **********:**:************ *****

© 1998-2018