Dataset for protein E1B 19K of organism Human adenovirus C serotype 5

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P03246_E1B19K-01      MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
Q6VGV8_E1B19K-01      MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
Q6WQ37_E1B19K-01      MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
                      **************************************************

P03246_E1B19K-01      FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
Q6VGV8_E1B19K-01      FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
Q6WQ37_E1B19K-01      FEELLKSCGELFDSLNLGHQALLQEKVIKTLDFSTPGRAAAAVAFLSFIK
                      **********************:***************************

P03246_E1B19K-01      DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQ
Q6VGV8_E1B19K-01      DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQ
Q6WQ37_E1B19K-01      DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQ
                      **************************************************

P03246_E1B19K-01      QQQEEARRRRQEQSPWNPRAGLDPRE
Q6VGV8_E1B19K-01      QQQEEARRRRQEQSPWNPRAGLDPRE
Q6WQ37_E1B19K-01      QQQEEARRRRQEQSPWNPRAGLDPRE
                      **************************

© 1998-2018