Dataset for protein adenoviridae of organism Human adenovirus C serotype 1

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q71BY5_E1B19K-01      -----------------------------------MRHIIC---------
Q71BY5_E1B19K-02      MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
                                                           :::*         

Q71BY5_E1B19K-01      ------------------HGGVITEEMAAS--------------------
Q71BY5_E1B19K-02      FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
                                        * .:: *::  :                    

Q71BY5_E1B19K-01      --------LLDQLIEEVLCLNLSLSPSQNRNLQDLPGVLKWCLLS-----
Q71BY5_E1B19K-02      DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQ
                              * .  : :.*.::*  :  .:.*   * . :. .::.     

Q71BY5_E1B19K-01      ------------------------------
Q71BY5_E1B19K-02      QQQQQQEEARRRRRQEQSPWNPRAGLDPRE
                                                    

© 1998-2018