Dataset for protein adenoviridae of organism Human adenovirus B serotype 7

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q5EY83_E1B19K-01        MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREE
A0A220VZ73_E1B19K-      MEVWAILEDLRQTRLLLENASDGVSGLWRFCFGGDLARLVFRIKQDYSVE
I1V161_E1B19K-01        MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVE
P03248_E1B19K-02        MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVE
Q6RK98_E1B19K-01        MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVE
                        ****************************** ****************  *

Q5EY83_E1B19K-01        FEKLLDDIPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
A0A220VZ73_E1B19K-      FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
I1V161_E1B19K-01        FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
P03248_E1B19K-02        FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
Q6RK98_E1B19K-01        FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
                        ******* ******************************************

Q5EY83_E1B19K-01        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
A0A220VZ73_E1B19K-      DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILR
I1V161_E1B19K-01        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILR
P03248_E1B19K-02        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
Q6RK98_E1B19K-01        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
                        ***********************************:**************

Q5EY83_E1B19K-01        HPPTMPAVLQEEQQEDNPRAGLDPPVEE
A0A220VZ73_E1B19K-      HPPTMPAVLQEEQQEDNPRAGLDPPVEE
I1V161_E1B19K-01        HPPTMPAVLQEEQQEDNPRAGLDPPVEE
P03248_E1B19K-02        HPPTMPAVLQEEQQEDNPRAGLDPPVEE
Q6RK98_E1B19K-01        HPPTMPAVLQEEQQEDNPRAGLDPPVEE
                        ****************************

© 1998-2018