Dataset for protein adenoviridae of organism Human adenovirus B serotype 3

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2KSL3_E1B19K-01      MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREE
Q2Y0J3_E1B19K-01      MEVWAILEDLRQTKLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREE
                      *************.************************************

Q2KSL3_E1B19K-01      FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
Q2Y0J3_E1B19K-01      FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
                      **************************************************

Q2KSL3_E1B19K-01      DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
Q2Y0J3_E1B19K-01      DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
                      **************************************************

Q2KSL3_E1B19K-01      HPPTMPAVLQEEQQEDNPRAGLDPPVEE
Q2Y0J3_E1B19K-01      HPPTMPAVLQEEQQEDNPRAGLDPPVEE
                      ****************************

© 1998-2018