Dataset for protein adenoviridae of organism Human adenovirus B serotype 16

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2KRU2_E1B19K-01      MEVWAILEDLRQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREE
R4HLE1_E1B19K-01      MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREE
                      **************************:***********************

Q2KRU2_E1B19K-01      FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
R4HLE1_E1B19K-01      FEKLLDNSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
                      ******:*******************************************

Q2KRU2_E1B19K-01      DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
R4HLE1_E1B19K-01      DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
                      **************************************************

Q2KRU2_E1B19K-01      HPPAMPAVLEEEQQEDNPRAGLDPPVEE
R4HLE1_E1B19K-01      HPPTMPAVLQEEQQEDNPRAGLDPPVEE
                      ***:*****:******************

© 1998-2018