Dataset for protein adenoviridae of organism Human adenovirus A serotype 12

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3G8WH01_E1B19K-      MELETVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVNRVKEDYREE
P04492_E1B19K-01        MELETVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVNRVKEDYREE
                        **************************************************

A0A3G8WH01_E1B19K-      FENILADCPGLLASLDLCHHLVFQEKVVRSLDFSSVGRTVASIAFLATIL
P04492_E1B19K-01        FENILADCPGLLASLDLCYHLVFQEKVVRSLDFSSVGRTVASIAFLATIL
                        ******************:*******************************

A0A3G8WH01_E1B19K-      DKWSEKSHLSWDYMLDYMSMQLWRAWLKRRVCIYSLARPLTMPPLPTLQE
P04492_E1B19K-01        DKWSEKSHLSWDYMLDYMSMQLWRAWLKRRVCIYSLARPLTMPPLPTLQE
                        **************************************************

A0A3G8WH01_E1B19K-      EKEEERNPAVVEK
P04492_E1B19K-01        EKEEERNPAVVEK
                        *************

© 1998-2019