Dataset for protein adenoviridae of organism Human adenovirus 23

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M0QUB4_E1B19K-01      MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEE
W8CZB0_E1B19K-01      MEVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEE
                      *:*****.**.************************************:**

M0QUB4_E1B19K-01      FENLFADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLV
W8CZB0_E1B19K-01      FENLFADCSGLLDSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLV
                      ****************:*********************************

M0QUB4_E1B19K-01      DKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRL
W8CZB0_E1B19K-01      DKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRL
                      *****:********************:***********************

M0QUB4_E1B19K-01      HRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
W8CZB0_E1B19K-01      HRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
                      ********************************

© 1998-2018