Dataset for protein adenoviridae of organism Human adenovirus 22

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


C5HDR2_E1B19K-01      MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLVEDSSDGC
D3GBW3_E1B19K-01      --------------------------MDVWTILADFSKTRRLVEDSSDGC
                                                ************************

C5HDR2_E1B19K-01      SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQ
D3GBW3_E1B19K-01      SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQ
                      **************************************************

C5HDR2_E1B19K-01      ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
D3GBW3_E1B19K-01      ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
                      **************************************************

C5HDR2_E1B19K-01      AWVRQRGQRILNYWLIQPAVPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
D3GBW3_E1B19K-01      AWVRQRGQRILNYWLIQPAVPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
                      **************************************************

C5HDR2_E1B19K-01      PPSEEELD
D3GBW3_E1B19K-01      PPSEEELD
                      ********

© 1998-2018