Dataset for protein adenoviridae of organism Human adenovirus 19

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B9A5Q1_E1B19K-01      MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEE
B9A5T7_E1B19K-01      MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEE
                      ***********************************************:**

B9A5Q1_E1B19K-01      FENLFADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLV
B9A5T7_E1B19K-01      FENLFADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLV
                      **************************************************

B9A5Q1_E1B19K-01      DKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRL
B9A5T7_E1B19K-01      DKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRL
                      *****:********************:************:**********

B9A5Q1_E1B19K-01      HRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
B9A5T7_E1B19K-01      HRQTSMLEEEMRQAMDENPRSGLDPPSEEELN
                      *******************************:

© 1998-2018