Dataset for protein Mcl-1 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

199 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      ------MFG---FQVVIR-----------LNLYCGAI-------------
A0A3P8V8T6_MCL1-01      -----------------------------LDMVLISS-------------
B6V6J0_MCL1-01          ----------MMHQSVIAKQRPSTSFLIPCQFYCSGG-------------
F7ETY1_MCL1-01          ----------MMRQSVIAKQRTSAGFLIPCQFYCSGG-------------
H3AR18_MCL1-02          ------GYN-----------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          ---------------------------------MGGS-------------
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          ------MFN------KKS-----------MVLVCGGAPSMAPNTPASPGA
R4GAJ0_MCL1-02          ---------------------------------------MAPNTPASPGA
G1QAV8_MCL1-01          ------MFG-PKRNAFIG-----------LNLHCGGAVGGLWRQRSLHLL
A0A2K6F6N9_MCL1-01      -------------DLWIN-----------LGISCGRA-------------
M3XAP4_MCL1-03          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K6GI15_MCL1-03      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
C8YZ26_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5CFH3_MCL1-02      ------MFG-LQRNAVIG-----------LNLYCGGA-------------
F7GTF7_MCL1-03          ------MFG-LQRNAVIG-----------LNLYCGGA-------------
A0A2K6V5Y3_MCL1-03      ------MFG-LQRNAVIG-----------LNLYCGGA-------------
A0A2K5LXU8_MCL1-03      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5I9Q7_MCL1-03      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2I2YQH7_MCL1-03      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
Q07820_MCL1-04          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5W0W9_MCL1-03      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
F7HUE9_MCL1-02          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K6ECR0_MCL1-03      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5XSC7_MCL1-03      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2R9BYH6_MCL1-03      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
K7DE58_MCL1-03          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2I3M3D6_MCL1-03      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K6KRW9_MCL1-03      ------MFG-FKRNAVIG-----------LNLYCGGA-------------
A0A2K6PPL1_MCL1-03      ------MFG-FKRNAVIG-----------LNLYCGGA-------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      ------MFG-LRRNAVIG-----------LNLYCGGA-------------
G2HFR3_MCL1-01          MDICRLSAA-MREFYIVH-----------LDIY-----------------
A0A1L1RNM6_MCL1-01      ------MFA-VKRNAVIG-----------FNLYCGGG-------------
A0A1L1RNM6_MCL1-02      ------MFA-VKRNAVIG-----------FNLYCGGG-------------
F6ZMX1_MCL1-01          ------MLGPFKKNAVIG-----------LNLYCGGA-------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-02          ------MFG-LRRNAVIG-----------LNLYCG---------------
P97287_MCL1-01          ------MFG-LRRNAVIG-----------LNLYCGGA-------------
G3T756_MCL1-01          ------MFG-FKRNAVIG-----------LNLYCGGA-------------
G1L3M8_MCL1-02          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2U3V2H3_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
K9IWB2_MCL1-03          ------MFG-LQRNAVIG-----------LNLYCGGA-------------
K9IWB2_MCL1-02          ------MFG-LQRNAVIG-----------LNLYCGGA-------------
K9IWB2_MCL1-01          ------MFG-LQRNAVIG-----------LNLYCGGA-------------
B4DU51_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A287DCH9_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCG---------------
A0A287DCH9_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A452GAH0_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5I9Q7_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          ------MFG-LQRNAVIG-----------LNLYCGGA-------------
A0A2K5EPY9_MCL1-02      ------SQS-YNNLKIT---------------------------------
A0A2K5EPY9_MCL1-01      ------NAS-CSRPACF---------------------------------
J9PBC4_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5C7L5_MCL1-01      ------MFG-LQRNALIG-----------LNLYCEWA-------------
Q9Z1P3_MCL1-01          ------MFG-LRRNAVIG-----------LNLYCGGA-------------
A5PJR2_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A452GAH0_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
G1L3M8_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
F7AVA6_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
G1T2Q0_MCL1-02          ------MFS-LRRNAVIG-----------LNLYLGGP-------------
G1T2Q0_MCL1-01          ------MFS-LRRNAVIG-----------LNLYLGGP-------------
M3XAP4_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
Q7YRZ9_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
J9PBC4_MCL1-02          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
Q8HYS5_MCL1-01          ------MFG-LKRNAVIR-----------TQLYCGGA-------------
M3XZZ5_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A452RHX5_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
H0XFB7_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K6GI15_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
F7GTF7_MCL1-02          ------MFG-LQRNAVIG-----------LNLYCGGA-------------
A0A2K5CFH3_MCL1-01      ------MFG-LQRNAVIG-----------LNLYCGGA-------------
A0A2K6V5Y3_MCL1-01      ------MFG-LQRNAVIG-----------LNLYCGGA-------------
A0A2K6KRW9_MCL1-01      ------MFG-FKRNAVIG-----------LNLYCGGA-------------
A0A2K6PPL1_MCL1-01      ------MFG-FKRNAVIG-----------LNLYCGGA-------------
A0A2K5XSC7_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A0D9RZP5_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5W0W9_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
I7G687_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
F7HUE9_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K6ECR0_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2I3M3D6_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5LXU8_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2I3GB35_MCL1-02      ------MFG-LRRNAVIG-----------LNLYCGGA-------------
H2N5Y9_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
Q07820_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2R9BYH6_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
K7DE58_MCL1-01          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2I2YQH7_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5I9Q7_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
M3XAP4_MCL1-02          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K6GI15_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
F7GTF7_MCL1-01          ------MFG-LQRNAVIG-----------LNLYCGGA-------------
A0A2K5CFH3_MCL1-03      ------MFG-LQRNAVIG-----------LNLYCGGA-------------
A0A2K6V5Y3_MCL1-02      ------MFG-LQRNAVIG-----------LNLYCGGA-------------
A0A2K6KRW9_MCL1-02      ------MFG-FKRNAVIG-----------LNLYCGGA-------------
A0A2K6PPL1_MCL1-02      ------MFG-FKRNAVIG-----------LNLYCGGA-------------
A0A2K5LXU8_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5W0W9_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K6ECR0_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2I3M3D6_MCL1-01      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2K5XSC7_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2I3GB35_MCL1-01      ------MFG-LRRNAVIG-----------LNLYCGGA-------------
Q07820_MCL1-03          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2R9BYH6_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
K7DE58_MCL1-02          ------MFG-LKRNAVIG-----------LNLYCGGA-------------
A0A2I2YQH7_MCL1-02      ------MFG-LKRNAVIG-----------LNLYCGGA-------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
G3PJT0_MCL1-01          -----------------------------MNIIQRPKLAALNMT-GVMSC
A0A3Q3VP02_MCL1-01      -------------------------------------------------M
A0A3B5K5B3_MCL1-01      -------------------------------------MNIIANHTALRIM
H2MLZ3_MCL1-01          ---------------------------------------MFPLQKQMVNS
H2MLZ3_MCL1-02          ---------------------------------------MFPLQKQMVNS
A0A3B3CEX1_MCL1-02      ---------------------------------------MLPLQKHMVNS
A0A3B3CEX1_MCL1-01      ---------------------------------------MLPLQKHMVNS
A0A3Q3B4V7_MCL1-01      -----------------------------------------MFPKPKPSY
A0A3Q3B4V7_MCL1-02      -----------------------------------------MFPKPKPSY
A0A3Q2EDX8_MCL1-01      -----------------------------------------------MSY
A0A3Q2T2A9_MCL1-02      --------------------------------------MSKAPTSTQLVN
A0A3Q2T2A9_MCL1-01      --------------------------------------MSKAPTSTQLVN
A0A3B5PQ55_MCL1-02      ---------------------------------------MTANSTNALNY
A0A3B5PQ55_MCL1-01      ---------------------------------------MTANSTNALNY
A0A3P9Q4R7_MCL1-02      ---------------------------------------MTANSTTALNY
A0A3P9Q4R7_MCL1-01      ---------------------------------------MTANSTTALNY
A0A087X830_MCL1-01      ---------------------------------------MTANSTTALNY
A0A3B3YCD0_MCL1-01      ---------------------------------------MTANSTTALNY
A0A3P8VKS9_MCL1-02      -----------------------------MNII-KNNQAKLNVATGVLGC
A0A3P8VKS9_MCL1-01      -----------------------------MNII-KNNQAKLNVATGVLGC
A0A3P8VKS9_MCL1-05      -----------------------------MNII-KNNQAKLNVATGVLGC
A0A3P8VKS9_MCL1-04      -----------------------------MNII-KNNQAKLNVATGVLGC
A0A3P8VKS9_MCL1-03      -----------------------------MNII-KNNQAKLNVATGVLGC
I3JHR5_MCL1-01          ----------------------------------MTNFLMSKRNQCTFID
A0A3Q4HLQ8_MCL1-01      ----------------------------------MTNYMMSKRNQCTFID
A0A3P8NP63_MCL1-02      ----------------------------------MANYMMLKRNQCTLME
A0A3P8NP63_MCL1-03      ----------------------------------MANYMMLKRNQCTLME
A0A3Q2VNL8_MCL1-01      ----------------------------------MANYMMLKRNQCTLME
A0A3P8NP63_MCL1-01      ----------------------------------MANYMMLKRNQCTLME
A0A3P9BVM3_MCL1-01      ----------------------------------MANYMMLKRNQCTLME
A0A3B4G4Z6_MCL1-01      ----------------------------------MANYMMLKRNQCTLME
A0A2U9CJ81_MCL1-01      -----------------------------MNIIPSTKRAAFNVTTGVMGC
A0A3Q3IZW0_MCL1-01      -----------------------------MNIITSKKWADVNVTTEIM-S
A0A3Q1GX28_MCL1-02      ------------------------------MLPSGRTAMKL-ATGGMS-C
A0A3Q1GX28_MCL1-01      ------------------------------MLPSGRTAMKL-ATGGMS-C
A0A3B4XKA5_MCL1-01      -----------------------------MNLIQAPKQAAL-T--AVN-Y
A0A3Q3GP42_MCL1-01      -----------------------------MDIINMKRAAVS-VSAGVM-S
A0A3Q3M6G2_MCL1-02      -----------------------------MSFIPSTRRAAL-IP-GVM--
A0A3Q3M6G2_MCL1-01      -----------------------------MSFIPSTRRAAL-IP-GVM--
A0A3B1IEV7_MCL1-01      -------------------------------------------MNPTAIS
A0A3B4E3I4_MCL1-03      -------------------------------------------MESAAIS
A0A3B4E3I4_MCL1-02      -------------------------------------------ME-----
A0A3B4E3I4_MCL1-01      -------------------------------------------ME-----
A0A3B4AFB7_MCL1-01      --------------------------------------------------
Q8UWD6_MCL1-01          -----------------------------------------------MFA
F8W4Q8_MCL1-01          -----------------------------------------------MFA
Q568W5_MCL1-01          -----------------------------------------------MFA
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-02      -------------------------------------------------M
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------MALSLDFRRTAT
Q9I9N3_MCL1-01          --------------------------------------MALSLDFRRTAT
W5MMB7_MCL1-01          -----------------------------MSLSSLKRTSASAVIQLYCPN
A0A3B3R4U0_MCL1-01      --------------------------------MNLINRTTATGLF-----
A0A3B3SG34_MCL1-01      --------------------------------MNPQSLKSYAPIMVSMNY
A0A3Q2Y539_MCL1-01      -------------------------------MPESKRFPLYNFKVGLVDA
Q4SW32_MCL1-01          --------------------------------MSVIANRTAIDTM-----
D2ITA0_MCL1-03          -------------------------------MLSQKLTSNYGTSLVQTCW
D2ITA0_MCL1-04          -------------------------------MLSQKLTSNYGTSLVQTCW
Q0KFR9_MCL1-01          --------------------------------MSLSNSITRATTT-----
A0A3P8Y1W8_MCL1-01      --------------------------------MNLSKSLTRATTT-----
A0A3P8Y1W8_MCL1-02      --------------------------------MNLSKSLTRATTT-----
A0A3Q2XZL8_MCL1-01      --------------------------------MSMVQ--PTSQVLKPQGR
A0A3B4AFB7_MCL1-02      --------------------------------MNIINSPKRTALKLSTMG
A0A3B3VM25_MCL1-01      ---------------------------------------MTANSTTALNY
A0A3Q0RA11_MCL1-03      -------------------------------MNTCTMRNCRMGSYKNVMD
A0A3Q0RA11_MCL1-01      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------MNLIQ-SPKPTAFTAMNY
A0A3B4T8L9_MCL1-01      --------------------------------MNLIQ-SPKPTAFTAMNY
A0A3Q1EQB9_MCL1-02      --------------------------------MNMIP--TKRTTL--MNC
A0A3B4ZKP6_MCL1-01      --------------------------------MNIIP-TTKRTAL--MSC
A0A3Q1BKL8_MCL1-02      --------------------------------MNMIPTTTKRTAF--MNY
A0A3Q1EQB9_MCL1-01      --------------------------------MNMIP--TKRTTL--MNC
A0A3Q1BKL8_MCL1-01      --------------------------------MNMIPTTTKRTAF--MNY
A0A3P8RQX7_MCL1-02      --------------------------------MNMIPTTTKRTAF--MNY
A0A3P8RQX7_MCL1-01      --------------------------------MNMIPTTTKRTAF--MNY
                                                                          

A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      -------------PPGPRLLA-----------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          --G---SSEKTLSARGASPWDPDMDTH-----------------------
F7ETY1_MCL1-01          --GGGNASEKAVNDRGASPWDADMEAHRDK--------------------
H3AR18_MCL1-02          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          GGGVGESSGGNNNDGGGVSV------------------------------
R4GAJ0_MCL1-02          GGGVGESSGGNNNDGGGVSV------------------------------
G1QAV8_MCL1-01          QEGGPCPQESGAGRETGTVI------------------------------
A0A2K6F6N9_MCL1-01      --DLGWAWL-GLK-------------------------------------
M3XAP4_MCL1-03          --GLAAGSG-GASSSGGRLV------------------------------
A0A2K6GI15_MCL1-03      --GLGAGSS-GATPPGGRLL------------------------------
C8YZ26_MCL1-01          --GLGAGSG-GATRPGGRLL------------------------------
A0A2K5CFH3_MCL1-02      --GLGAGSG-GATPPGGRLL------------------------------
F7GTF7_MCL1-03          --GLGAGSG-GATPPGGRLL------------------------------
A0A2K6V5Y3_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
A0A2K5LXU8_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
A0A2K5I9Q7_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
A0A2I2YQH7_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
Q07820_MCL1-04          --GLGAGSG-GATRPGGRLL------------------------------
A0A2K5W0W9_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
F7HUE9_MCL1-02          --GLGAGSG-GATPPGGRLL------------------------------
A0A2K6ECR0_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
A0A2K5XSC7_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
A0A2R9BYH6_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
K7DE58_MCL1-03          --GLGAGSG-GATPPGGRLL------------------------------
A0A2I3M3D6_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
A0A2K6KRW9_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
A0A2K6PPL1_MCL1-03      --GLGAGSG-GATPPGGRLL------------------------------
K7DE58_MCL1-04          -----SVET-----------------------------------------
A0A2I3GB35_MCL1-03      --GLGAGSG-----------------------------------------
G2HFR3_MCL1-01          ----PPPEC-----------------------------------------
A0A1L1RNM6_MCL1-01      --SPGLV---PASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAG----
A0A1L1RNM6_MCL1-02      --SPGLV---PASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAG----
F6ZMX1_MCL1-01          --GMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLI
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-02          --------------------------------------------------
P97287_MCL1-01          --SLGAGGGSPAGAR-----LVAEEAKARREGGGE---------------
G3T756_MCL1-01          --GLG--AGGCATPPGGRLPAPGKEATARQEVGGGD--------AG----
G1L3M8_MCL1-02          --GLGAGSGGGXS--GGRLLASGKEATARREIGGGEAGAVIGGSAG----
A0A2U3V2H3_MCL1-01      --GLGPDSGSGASAPGRRLLAAGKEATAGREVGGGEAGEVIGGSAG----
K9IWB2_MCL1-03          --GLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG----
K9IWB2_MCL1-02          --GLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG----
K9IWB2_MCL1-01          --GLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG----
B4DU51_MCL1-01          --GLG--AGSGG--------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      --GLG--ASGGATPPGAQLLAAEKEAAARREAGGGE--------------
A0A452GAH0_MCL1-02      --GLGQGS--GASSPGGRLLAAGKEATAR---------------AG----
A0A2K5I9Q7_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          --GLGPGSG-S---------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          --GLGAGSG-GASSSGGRLLASGKEATTRREGGGGEAGAVIGGSAG----
A0A2K5C7L5_MCL1-01      --GLGTGSG-GTTPPGGRLLATEKEASAQREVGGGEAGVVIGGSAG----
Q9Z1P3_MCL1-01          --SLGAG---GGSPAGTRLAA--EEAKARRE-GGGEA-------------
A5PJR2_MCL1-01          --GLGQGS--GASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAG----
A0A452GAH0_MCL1-01      --GLGQGS--GASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAG----
G1L3M8_MCL1-01          --GLGAGSG-GGXS-GGRLLASGKEATARREIGGGEAGAVIGGSAG----
F7AVA6_MCL1-01          --GLGAGGG-GASSPGGRLLAAGKEATARREGGGGEAGAVIGGSAG----
G1T2Q0_MCL1-02          --GLGAGGG-GVAPPAERLLAAEKEAAARLEVGGGEAGAVIGGSPG----
G1T2Q0_MCL1-01          --GLGAGGG-GVAPPAERLLAAEKEAAARLEVGGGEAGAVIGGSPG----
M3XAP4_MCL1-01          --GLAAGSG-GASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAG----
Q7YRZ9_MCL1-01          --GLAAGSG-GASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAG----
J9PBC4_MCL1-02          --GLGAGSG-GASSSGGRLLASGKEATTRREGGGGEAGAVIGGSAG----
Q8HYS5_MCL1-01          --GLGAGSG-GASSSGGRLLASGREATTRREGGGGEAGAVIGGSAG----
M3XZZ5_MCL1-01          --GLGAGTG-GASSSGGRLLASGKEATARREVGGGEAGAVIGGSAG----
A0A452RHX5_MCL1-01      --GLGAGSG-GAASSGGRLLASGKEATARREVGGGEAGAVIGGSAG----
H0XFB7_MCL1-01          --GLGAGSG-GATPPGGRLLAAEKEAAARREAGGGEAGEVIGGSPG----
A0A2K6GI15_MCL1-02      --GLGAGSS-GATPPGGRLLAAEKEATARREVGGGEDGTVIGGSPG----
F7GTF7_MCL1-02          --GLGAGSG-GATPPGGRLLATEKEASAQREVGGGEAGAVTGGSAG----
A0A2K5CFH3_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASAQREVGGGEAGAVIGGSAG----
A0A2K6V5Y3_MCL1-01      --GLGAGSG-GATPPGGRLLAAEKEASAQREVGGGEAGAVIGGSAG----
A0A2K6KRW9_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGESAG----
A0A2K6PPL1_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGESAG----
A0A2K5XSC7_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
A0A0D9RZP5_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
A0A2K5W0W9_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
I7G687_MCL1-01          --GLGAGSS-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
F7HUE9_MCL1-01          --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
A0A2K6ECR0_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
A0A2I3M3D6_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGTAG----
A0A2K5LXU8_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
A0A2I3GB35_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
H2N5Y9_MCL1-01          --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
Q07820_MCL1-01          --GLGAGSG-GATRPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
A0A2R9BYH6_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
K7DE58_MCL1-01          --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
A0A2I2YQH7_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
A0A2K5I9Q7_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
M3XAP4_MCL1-02          --GLAAGSG-GASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAG----
A0A2K6GI15_MCL1-01      --GLGAGSS-GATPPGGRLLAAEKEATARREVGGGEDGTVIGGSPG----
F7GTF7_MCL1-01          --GLGAGSG-GATPPGGRLLATEKEASAQREVGGGEAGAVTGGSAG----
A0A2K5CFH3_MCL1-03      --GLGAGSG-GATPPGGRLLATEKEASAQREVGGGEAGAVIGGSAG----
A0A2K6V5Y3_MCL1-02      --GLGAGSG-GATPPGGRLLAAEKEASAQREVGGGEAGAVIGGSAG----
A0A2K6KRW9_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGESAG----
A0A2K6PPL1_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGESAG----
A0A2K5LXU8_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
A0A2K5W0W9_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
A0A2K6ECR0_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
A0A2I3M3D6_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGTAG----
A0A2K5XSC7_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG----
A0A2I3GB35_MCL1-01      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
Q07820_MCL1-03          --GLGAGSG-GATRPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
A0A2R9BYH6_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
K7DE58_MCL1-02          --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
A0A2I2YQH7_MCL1-02      --GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG----
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
G3PJT0_MCL1-01          IILPQNGVAP------------------MRQLAMGSAKDSHNGNAG----
A0A3Q3VP02_MCL1-01      NVLFQNGVVSGPTR--------------SSQIGMGSCLDSHNGNVA----
A0A3B5K5B3_MCL1-01      NVVFQNGVVDGAGH--------------SSPL----IPMASRGSLS----
H2MLZ3_MCL1-01          YITSNCGFTGHILGSR--------AGEMSARVPLPSTLASHVANPD----
H2MLZ3_MCL1-02          YITSNCGFTGHILGSR--------AGEMSARVPLPSTLASHVANPD----
A0A3B3CEX1_MCL1-02      YITPSCGCTALFGG----------AGERSARVPLTSATASRGANPD----
A0A3B3CEX1_MCL1-01      YITPSCGCTALFGG----------AGERSARVPLTSATASRGANPD----
A0A3Q3B4V7_MCL1-01      IFFLQNGVVDGLHR------------DTSPQVSIGASLGSENGSVA----
A0A3Q3B4V7_MCL1-02      IFFLQNGVVDGLHR------------DTSPQVSIGASLGSENGSVA----
A0A3Q2EDX8_MCL1-01      LILPQNGVVDGQTHYS--------PEIAAPEIPMNSPMGSLHRN------
A0A3Q2T2A9_MCL1-02      CLISQNGVGDGQPHYR--------PGLQLPEVEMSSSSEDLRWD------
A0A3Q2T2A9_MCL1-01      CLISQNGVGDGQPHYR--------PGLQLPEVEMSSSSEDLRWD------
A0A3B5PQ55_MCL1-02      LIFSQNGVGNGQTHYD--------QGLGVPEVAMGSTVESLHSP------
A0A3B5PQ55_MCL1-01      LIFSQNGVGNGQTHYD--------QGLGVPEVAMGSTVESLHSP------
A0A3P9Q4R7_MCL1-02      LIFSQNGVGNGQTHYD--------QGLVVPEVAMGSRVESLHSP------
A0A3P9Q4R7_MCL1-01      LIFSQNGVGNGQTHYD--------QGLVVPEVAMGSRVESLHSP------
A0A087X830_MCL1-01      LIFSQNGVGDGQTHYD--------QGLVVPEVAMGATVDSLHSP------
A0A3B3YCD0_MCL1-01      LIFSQNGVGDGQTHYD--------QGLVVPEVAMGATVDSLHSP------
A0A3P8VKS9_MCL1-02      FIVPQNGVVNGTMHYG--------TGNSTPIALASSLSTHNDSMSS----
A0A3P8VKS9_MCL1-01      FIVPQNGVVNGTMHYG--------TGNSTPIALASSLSTHNDSMSS----
A0A3P8VKS9_MCL1-05      FIVPQNGVVNGTMHYG--------TGNSTPIALASSLSTHNDSMSS----
A0A3P8VKS9_MCL1-04      FIVPQNGVVNGTMHYG--------TGNSTPIALASSLSTHNDSMSS----
A0A3P8VKS9_MCL1-03      FIVPQNGVVNGTMHYG--------TGNSTPIALASSLSTHNDSMSS----
I3JHR5_MCL1-01          YLLPQNGVLEGPMHYG--------SGKSSPQNATGSSKDSSNGI-V----
A0A3Q4HLQ8_MCL1-01      YLIPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGI-V----
A0A3P8NP63_MCL1-02      YLIPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGI-V----
A0A3P8NP63_MCL1-03      YLIPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGI-V----
A0A3Q2VNL8_MCL1-01      YLIPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGI-V----
A0A3P8NP63_MCL1-01      YLIPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGI-V----
A0A3P9BVM3_MCL1-01      YLIPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGI-V----
A0A3B4G4Z6_MCL1-01      YLIPQNGVLEGPMHYG--------SGNSSPQNATGSSKDSSNGI-V----
A0A2U9CJ81_MCL1-01      LILPQNGVVEGAMHYG--------SGNSLPQIAVGSVIDSRGGNVG----
A0A3Q3IZW0_MCL1-01      LILPQNGVVEGSMHCG--------S-NTSPQFAVGSSIDSCKGNVG----
A0A3Q1GX28_MCL1-02      LMLPQNGVVE----YS--------SGVNSPQITMSSSIDACNGN------
A0A3Q1GX28_MCL1-01      LMLPQNGVVE----YS--------SGVNSPQITMSSSIDACNGN------
A0A3B4XKA5_MCL1-01      CICRQNGGLE-TWRDS--------SGDSSPEIAIGSTLCCDNGNVV----
A0A3Q3GP42_MCL1-01      FMMPQNGVGKGQMHYG--------PEASSPQIAMGSSLASQNGNVG----
A0A3Q3M6G2_MCL1-02      IVLPQDGVLEGPVHYD--------SRDPSTQF----TLDSRNGN-G----
A0A3Q3M6G2_MCL1-01      IVLPQDGVLEGPVHYD--------SRDPSTQF----TLDSRNGN-G----
A0A3B1IEV7_MCL1-01      LLCDGTSPVLYRTEKE--------EKLPRTERPERGLEG-----------
A0A3B4E3I4_MCL1-03      LFCNGAGRIPFNKGSE--------SQLDRPDRPDRGLEG-----------
A0A3B4E3I4_MCL1-02      --AHGGVQINMAAHPG--------GSICAPVLHGSSFGGPVTLIYL----
A0A3B4E3I4_MCL1-01      --AHGGVQINMAAHPG--------GSICAPVLHGSSFGGPVTLIYL----
A0A3B4AFB7_MCL1-01      -----------DTTCL--------QGVLTPPLGTAHICGSPHPRPT----
Q8UWD6_MCL1-01          GRNNDNGFWPCTGLQS--------KPLVIPELKAH---------------
F8W4Q8_MCL1-01          GRNNDNGFWPCTGLQS--------KPLVIPELKAH---------------
Q568W5_MCL1-01          GRNNDNGFWPCTGLQS--------KPLVIPELKAH---------------
A0A3B1K5R1_MCL1-01      ---MMSPQDMCSYNKK--------TADIVPRVAVRGGGGGAGLSLG----
A0A3B4C6H5_MCL1-01      -----------------------------------------LFSFV----
A0A3B4C6H5_MCL1-02      VRLFGVGLRVVHYAKY--------PKTVFPSLLAK-----RPFTLG----
A0A3B4C6H5_MCL1-03      ---MMMSPKEMYFDK----------KTVFPSLLAK-----RPFTLG----
Q568V1_MCL1-01          MSFLAQGVQTPTLKTC--------------------VEDELDGYIE----
Q1L8X3_MCL1-01          MSFFAQGVQTPTLKTC--------------------VEDELDGYIE----
Q9I9N3_MCL1-01          MSFFAQGVQTPTLKTC--------------------VEDELDGYTE----
W5MMB7_MCL1-01          ATTIHPGLASLGPCPG---GSAARTAVLDPMLKADYAEDELDNYSAEPVA
A0A3B3R4U0_MCL1-01      ----CPGIKNGVKQNG--FYSFVSASLPVAPLKAKSEEELDSLDEGERFH
A0A3B3SG34_MCL1-01      HRPLHHGVLGKSILQC---LDSSARAANTPCLESSGLWDDELDNCTD---
A0A3Q2Y539_MCL1-01      LMLPPKAVVQGSMASQ----------------------------------
Q4SW32_MCL1-01          NVMFQNGVGDADLSSS--------------QIPMGSPRDAFNGN------
D2ITA0_MCL1-03          FNSPQNGGEERNMDFHSEGSHTTTEGALPLMATFKS--------------
D2ITA0_MCL1-04          FNSPQNGGEERNMDFHSEGSHTTTEGALPLMATFKS--------------
Q0KFR9_MCL1-01          MLHFQNGGSSYLADDARPLYYFQGAGAICAGASPKSK--VDLGNG-----
A0A3P8Y1W8_MCL1-01      MLNVQNGVVGSLYSGA-PLCYFSPTGPLCPAASSKSKMDVDLGNG-----
A0A3P8Y1W8_MCL1-02      MLNVQNGVVGSLYSGA-PLCYFSPTGPLCPAASSKSKMDVDLGNG-----
A0A3Q2XZL8_MCL1-01      PMRPQNGVAEGLLQCN--------SPPVAAASTSPPQLHRAVATLGAVNC
A0A3B4AFB7_MCL1-02      LFLPQNGLAEGDMHCG--------AADSSAQMPRPATMDTRKGNTA----
A0A3B3VM25_MCL1-01      LIFSQNGVGDGQTHYD--------QGLVVPEVAMGATVDSLHSP------
A0A3Q0RA11_MCL1-03      LFLPQNGVVDGTMHYG--------SGNSSPQDATGTPKDS----------
A0A3Q0RA11_MCL1-01      -----------SLPF--------------------TSPDS----------
A0A3B4T8L9_MCL1-02      CICRQNGGLETWTD-G--------SGDSSPEIAIGSTICSHNGNVV----
A0A3B4T8L9_MCL1-01      CICRQNGGLETWTD-G--------SGDSSPEIAIGSTICSHNGNVV----
A0A3Q1EQB9_MCL1-02      LIFPQNGVVEGPMHYG--------SGDSSPQISVASSIDPQNGNLG----
A0A3B4ZKP6_MCL1-01      FILPQNGVVEGQMHYG--------SGDPSAQIPMASPLDSHNGNVG----
A0A3Q1BKL8_MCL1-02      LIFPQNGVVEGPMHYG--------SGDSSPQIAVASSIDSHNGNVG----
A0A3Q1EQB9_MCL1-01      LIFPQNGVVEGPMHYG--------SGDSSPQISVASSIDPQNGNLG----
A0A3Q1BKL8_MCL1-01      LIFPQNGVVEGPMHYG--------SGDSSPQIAVASSIDSHNGNVG----
A0A3P8RQX7_MCL1-02      LIFPQNGVVEGPMHYG--------SGDSSPQIAVASSIDSHNGNVG----
A0A3P8RQX7_MCL1-01      LIFPQNGVVEGPMHYG--------SGDSSPQIAVASSIDSHNGNVG----
                                                                          

A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
F7ETY1_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          -------------------------------------------------L
R4GAJ0_MCL1-01          -----PKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEG
R4GAJ0_MCL1-02          -----PKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEG
G1QAV8_MCL1-01          GWSAGASPQATLARDPGRVARPSPMGTEGPDGTAAPARWLFSPISRNC--
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-03          --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSC7_MCL1-03      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      ----------LWAAAGRAEAPRAPIGSGAAPHAPIGSAAARRAPPDSTSR
A0A1L1RNM6_MCL1-02      ----------LWAAAGRAEAPRAPIGSGAAPHAPIGSAAARRAPPDSTSR
F6ZMX1_MCL1-01          GGGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRCSSA
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-02          -------------------------GAEDPDVTASAERRLHKSPGLLAVP
P97287_MCL1-01          ---------AALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVP
G3T756_MCL1-01          -----ASPPAAVAPDGRRVVRPAPIGAEGPDVTAIPARPTFFAPTRRASP
G1L3M8_MCL1-02          -----ASPPAXXX--XXXXXXXXXXGAEGPDVTATPPRLLFLEPTRRASP
A0A2U3V2H3_MCL1-01      -----PSPPATLAPDARRVARPSPIGAEGPDVTATRARLLFFAPTRRASP
K9IWB2_MCL1-03          -----ASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASP
K9IWB2_MCL1-02          -----ASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASP
K9IWB2_MCL1-01          -----ASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASP
B4DU51_MCL1-01          --------------------------------ATRPGGRLL---------
A0A287DCH9_MCL1-02      -------------------------GAEVPDVTATPARRLFFAPTYCVSP
A0A287DCH9_MCL1-01      ---------AAQPPSARRVARPVPIGAEVPDVTATPARRLFFAPTYCVSP
A0A452GAH0_MCL1-02      -----PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASP
A0A2K5I9Q7_MCL1-01      -----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
G1PZ39_MCL1-01          -------------------APPSPISGRGPRRHRDPSRGGCLRPLAVRGC
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          -----ASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASP
A0A2K5C7L5_MCL1-01      -----ASPSAALTPDAR----------------GSCGRCWFFAPTRRAAP
Q9Z1P3_MCL1-01          ----------ALLPGARVVARPPPVGAEDPDVTASAERRLLKSPGLLAVP
A5PJR2_MCL1-01          -----PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASP
A0A452GAH0_MCL1-01      -----PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASP
G1L3M8_MCL1-01          -----ASPPX---------------GAEGPDVTATPPRLLFLEPTRRASP
F7AVA6_MCL1-01          -----GSPQTTLAPDSLRVARPSPIGAEGPDVTAPSSRLLFFAPTRCASP
G1T2Q0_MCL1-02          -----ASPPAALAPDARRVARPAPIGAELPDVSATPARLLYLAPTRRASP
G1T2Q0_MCL1-01          -----A------------------IGAELPDVSATPARLLYLAPTRRASP
M3XAP4_MCL1-01          -----ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASP
Q7YRZ9_MCL1-01          -----ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASP
J9PBC4_MCL1-02          -----ASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASP
Q8HYS5_MCL1-01          -----ASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASP
M3XZZ5_MCL1-01          -----ASTPATLAPDARRVARPSPIGAEGPNVTATPPRLLFFEPTHRASP
A0A452RHX5_MCL1-01      -----ASPPATLAPDARRVARPSPIGAEGPDVTATPPRLLFLEPTRRASP
H0XFB7_MCL1-01          -----ASSPASLTPDARRVARPPPIGAEVPDVTATPTRLLFFAPTLRAAP
A0A2K6GI15_MCL1-02      -----ASPPASLTPEARRVARPAPIGAEVPDVTATPERLLFFAPTRRALP
F7GTF7_MCL1-02          -----ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAP
A0A2K5CFH3_MCL1-01      -----ASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAP
A0A2K6V5Y3_MCL1-01      -----ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAP
A0A2K6KRW9_MCL1-01      -----ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAP
A0A2K6PPL1_MCL1-01      -----ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAP
A0A2K5XSC7_MCL1-01      -----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLFFFAPTRRAAP
A0A0D9RZP5_MCL1-01      -----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
A0A2K5W0W9_MCL1-02      -----ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAGP
I7G687_MCL1-01          -----ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAAP
F7HUE9_MCL1-01          -----ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRASP
A0A2K6ECR0_MCL1-01      -----ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAGP
A0A2I3M3D6_MCL1-02      -----ASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFAPTRRAAP
A0A2K5LXU8_MCL1-01      -----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
A0A2I3GB35_MCL1-02      -----ASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFAPTRRAAP
H2N5Y9_MCL1-01          -----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLFFFAPTRRAAP
Q07820_MCL1-01          -----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
A0A2R9BYH6_MCL1-01      -----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
K7DE58_MCL1-01          -----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
A0A2I2YQH7_MCL1-01      -----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
A0A2K5I9Q7_MCL1-02      -----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
M3XAP4_MCL1-02          -----ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASP
A0A2K6GI15_MCL1-01      -----ASPPASLTPEARRVARPAPIGAEVPDVTATPERLLFFAPTRRALP
F7GTF7_MCL1-01          -----ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAP
A0A2K5CFH3_MCL1-03      -----ASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAP
A0A2K6V5Y3_MCL1-02      -----ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAP
A0A2K6KRW9_MCL1-02      -----ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAP
A0A2K6PPL1_MCL1-02      -----ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAP
A0A2K5LXU8_MCL1-02      -----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
A0A2K5W0W9_MCL1-01      -----ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAGP
A0A2K6ECR0_MCL1-02      -----ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAGP
A0A2I3M3D6_MCL1-01      -----ASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFAPTRRAAP
A0A2K5XSC7_MCL1-02      -----ASPPAALTPDARRVARPPPIGAEVPDVTATPARLFFFAPTRRAAP
A0A2I3GB35_MCL1-01      -----ASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFAPTRRAAP
Q07820_MCL1-03          -----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
A0A2R9BYH6_MCL1-02      -----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
K7DE58_MCL1-02          -----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
A0A2I2YQH7_MCL1-02      -----ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAP
G3WBC5_MCL1-01          -------------------------------DVTAPPRPFFFAPGGRCSP
W5QI41_MCL1-01          ------------------------------------------------GS
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          ----------------------------------MFGLKRNAVIGLNLYC
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
G3PJT0_MCL1-01          -TNDTPKRPSALGVNSANG-------------------------------
A0A3Q3VP02_MCL1-01      -LNDTSKRPNLLVVNPTKE-------------------------------
A0A3B5K5B3_MCL1-01      -GNDSPKRPSKLSVIAPKV-------------------------------
H2MLZ3_MCL1-01          -PSDQLKRPQDLE-------------------------------------
H2MLZ3_MCL1-02          -PSDQLKRPQDLE-------------------------------------
A0A3B3CEX1_MCL1-02      -PSEQMKRPQDLDMLGNKSP------------------------------
A0A3B3CEX1_MCL1-01      -PSEQMKRPQDLDMLGNKSP------------------------------
A0A3Q3B4V7_MCL1-01      -SCNSSKRPKDLVMPPLKG-------------------------------
A0A3Q3B4V7_MCL1-02      -SCNSSKRPKDLVMPPLKG-------------------------------
A0A3Q2EDX8_MCL1-01      ----LMKRPKDLQV-ATNG-------------------------------
A0A3Q2T2A9_MCL1-02      -CS---KRPKNLRVMARNG-------------------------------
A0A3Q2T2A9_MCL1-01      -CS---KRPKNLRVMARNG-------------------------------
A0A3B5PQ55_MCL1-02      -KDPFMKRPTNLGV---NG-------------------------------
A0A3B5PQ55_MCL1-01      -KDPFMKRPTNLGV---NG-------------------------------
A0A3P9Q4R7_MCL1-02      -MDPFKKRPTNLAVTASNG-------------------------------
A0A3P9Q4R7_MCL1-01      -MDPFKKRPTNLAVTASNG-------------------------------
A0A087X830_MCL1-01      -KDPYKKRPTNLAVSASNG-------------------------------
A0A3B3YCD0_MCL1-01      -KDPYKQRPTNLAVTASNG-------------------------------
A0A3P8VKS9_MCL1-02      -VTETQRRPKDLQVNTANG-------------------------------
A0A3P8VKS9_MCL1-01      -VTETQRRPKDLQVNTANG-------------------------------
A0A3P8VKS9_MCL1-05      -VTETQRRPKDLQVNTANG-------------------------------
A0A3P8VKS9_MCL1-04      -VTETQRRPKDLQVNTANG-------------------------------
A0A3P8VKS9_MCL1-03      -VTETQRRPKDLQVNTANG-------------------------------
I3JHR5_MCL1-01          -SNGTPKRPNNLGVTSTNG-------------------------------
A0A3Q4HLQ8_MCL1-01      -SNGTPKRPDNLEVTSTNG-------------------------------
A0A3P8NP63_MCL1-02      -SNGTPKRPDNLEVTSTNG-------------------------------
A0A3P8NP63_MCL1-03      -SNGTPKRPDNLEVTSTNG-------------------------------
A0A3Q2VNL8_MCL1-01      -SNGTPKRPDNLEVTSTNG-------------------------------
A0A3P8NP63_MCL1-01      -SNGTPKRPDNLEVTSTNG-------------------------------
A0A3P9BVM3_MCL1-01      -SNGTPKRPDNLEVTSTNG-------------------------------
A0A3B4G4Z6_MCL1-01      -SNGTPKRPDNLEVTSTNG-------------------------------
A0A2U9CJ81_MCL1-01      -AGDAPKRPKNLQVSATKA-------------------------------
A0A3Q3IZW0_MCL1-01      -PNNTLKRPKILDVSSTNG-------------------------------
A0A3Q1GX28_MCL1-02      ---AALKRPKNLDVSSSNG-------------------------------
A0A3Q1GX28_MCL1-01      ---AALKRPKNLDVSSSNG-------------------------------
A0A3B4XKA5_MCL1-01      -PNDNSKRPKSLEVTSTNG-------------------------------
A0A3Q3GP42_MCL1-01      -SNETTKRPKALVVNSGN--------------------------------
A0A3Q3M6G2_MCL1-02      -GTANPKRPKNLEVSSTNG-------------------------------
A0A3Q3M6G2_MCL1-01      -GTANPKRPKNLEVSSTNG-------------------------------
A0A3B1IEV7_MCL1-01      -LQSAKG-------------------------------------------
A0A3B4E3I4_MCL1-03      -LQAAPGPA-------S---------------------------------
A0A3B4E3I4_MCL1-02      -IHGGQGGS-------S---------------------------------
A0A3B4E3I4_MCL1-01      -IHGGQGGS-------S---------------------------------
A0A3B4AFB7_MCL1-01      -ALVMKNELLNKNTREE---------------------------------
Q8UWD6_MCL1-01          --------------NQF---------------------------------
F8W4Q8_MCL1-01          --------------NQF---------------------------------
Q568W5_MCL1-01          --------------NQF---------------------------------
A0A3B1K5R1_MCL1-01      -LAADIRPT-----------------------------------------
A0A3B4C6H5_MCL1-01      -WEFSRKWPWNFLWEKL---------------------------------
A0A3B4C6H5_MCL1-02      -ISSQTRAP-------R---------------------------------
A0A3B4C6H5_MCL1-03      -ISSQTRAP-------R---------------------------------
Q568V1_MCL1-01          -EEEAPLKRLRPGTNGLKG-------------------------------
Q1L8X3_MCL1-01          -EEEAPLKRLRPGTNGLKG-------------------------------
Q9I9N3_MCL1-01          -EEEAPLKRLRPGTNGLKG-------------------------------
W5MMB7_MCL1-01          TSAWIPKSPRSLPAGLKLG-------------------------------
A0A3B3R4U0_MCL1-01      GAPKTERRDCEHHLRASG--------------------------------
A0A3B3SG34_MCL1-01      -EVDVCPCSTRLAKRDSEK-------------------------------
A0A3Q2Y539_MCL1-01      -LQEVERRSDNSD-------------------------------------
Q4SW32_MCL1-01          -VGDSPKRPSKLTVVKPKV-------------------------------
D2ITA0_MCL1-03          -GDERKPRPTELG----RG-------------------------------
D2ITA0_MCL1-04          -GDERKPRPTELG----RG-------------------------------
Q0KFR9_MCL1-01          -TGDTPPRPTTLGVNVVKS-------------------------------
A0A3P8Y1W8_MCL1-01      -TADTPVRPTKLEVNMTKP-------------------------------
A0A3P8Y1W8_MCL1-02      -TADTPVRPTKLEVNMTKP-------------------------------
A0A3Q2XZL8_MCL1-01      NSGAAKPRPSALEILCKGG-------------------------------
A0A3B4AFB7_MCL1-02      -SSGSP-HPRPTALVMKNE-------------------------------
A0A3B3VM25_MCL1-01      -KDPYKQRPTNLAVTASNG-------------------------------
A0A3Q0RA11_MCL1-03      --NGTPKRPNNLGVVSTNG-------------------------------
A0A3Q0RA11_MCL1-01      --NGTPKRPNNLGVVSTNG-------------------------------
A0A3B4T8L9_MCL1-02      -PNDNSKRPKSLEVTSTNG-------------------------------
A0A3B4T8L9_MCL1-01      -PNDNSKRPKSLEVTSTNG-------------------------------
A0A3Q1EQB9_MCL1-02      -SSDTPKRPKNLGV---NG-------------------------------
A0A3B4ZKP6_MCL1-01      -SGATPKRPKNLGVSTTNG-------------------------------
A0A3Q1BKL8_MCL1-02      -SNETPKRPKNLGV---NG-------------------------------
A0A3Q1EQB9_MCL1-01      -SSDTPKRPKNLGV---NG-------------------------------
A0A3Q1BKL8_MCL1-01      -SNETPKRPKNLGV---NG-------------------------------
A0A3P8RQX7_MCL1-02      -SSETPKRPKNLGV---NG-------------------------------
A0A3P8RQX7_MCL1-01      -SSETPKRPKNLGV---NG-------------------------------
                                                                          

A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          ---------------RPQLNGLGFNNGG----------------------
F7ETY1_MCL1-01          -------------LDRPQLNGFGFNSGG----------------------
H3AR18_MCL1-02          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          -----LPSPQSELDEDEDYMDVQSDSRG----------------------
H0XHA5_MCL1-01          PDQMEAQVADAVKSPEGEVASCEPEPLK----------------------
R4GAJ0_MCL1-01          EGEQPKWRPASLPLPEGELDGCEEAEEE----------------------
R4GAJ0_MCL1-02          EGEQPKWRPASLPLPEGELDGCEEAEEE----------------------
G1QAV8_MCL1-01          PEELGALAADAIMSPGEELGRYEPEP------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-03          --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSC7_MCL1-03      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      PVAL--------WSPEEELDGCEPESE-----------------------
A0A1L1RNM6_MCL1-02      PVAL--------WSPEEELDGCEPESE-----------------------
F6ZMX1_MCL1-01          PAEVADGAADVPMCPEEELDGYEPEPPG----------------------
A0A286Y1M5_MCL1-01      ------------MSPEEELDGYEPEPLG----------------------
P97287_MCL1-02          PEEMAASAAAAIVSPEEELDGCEPEAIG----------------------
P97287_MCL1-01          PEEMAASAAAAIVSPEEELDGCEPEAIG----------------------
G3T756_MCL1-01          PVEMEALAADAIMSPEEELDGYEPEPLG----------------------
G1L3M8_MCL1-02          PEEMEGPAADAIMSPEEELDGYEPEPLG----------------------
A0A2U3V2H3_MCL1-01      PEEMESSVSDAIMSPEEELDGCEPEPLG----------------------
K9IWB2_MCL1-03          PEEMESPASDAIMSPEEELDGYEPEPLG----------------------
K9IWB2_MCL1-02          PEEMESPASDAIMSPEEELDGYEPEPLG----------------------
K9IWB2_MCL1-01          PEEMESPASDAIMSPEEELDGYEPEPLG----------------------
B4DU51_MCL1-01          ATEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A287DCH9_MCL1-02      PEKMEAPAAA--MSPEEELDGYEPEPLG----------------------
A0A287DCH9_MCL1-01      PEKMEAPAAA--MSPEEELDGYEPEPLG----------------------
A0A452GAH0_MCL1-02      PEEMESPISDAIMSPEEELDGCEPDPLG----------------------
A0A2K5I9Q7_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
G1PZ39_MCL1-01          PRRWKAAAADAIMSPEEELDGYEPEPLG----------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          PEEMEGPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K5C7L5_MCL1-01      LEEMEAPAADAIMSPEEELDRYEPEPLG----------------------
Q9Z1P3_MCL1-01          PEEMAASAA-AIMSPEEELDGCEPEVLS----------------------
A5PJR2_MCL1-01          PEEMESPISDAIMSPEEELDGCEPDPLG----------------------
A0A452GAH0_MCL1-01      PEEMESPISDAIMSPEEELDGCEPDPLG----------------------
G1L3M8_MCL1-01          PEEMEGPAADAIMSPEEELDGYEPEPLG----------------------
F7AVA6_MCL1-01          PEGMEAPAADAIMSPEEELDGYEPEPLG----------------------
G1T2Q0_MCL1-02          LEEMEAPAADAIMSPEEELDGYEPEPLA----------------------
G1T2Q0_MCL1-01          LEEMEAPAADAIMSPEEELDGYEPEPLA----------------------
M3XAP4_MCL1-01          PEKMEGPAADAIMSPEEELDGYEPEPLG----------------------
Q7YRZ9_MCL1-01          PEEMEGPAADAIMSPEEELDGYEPEPLG----------------------
J9PBC4_MCL1-02          PEEMEGPAADAIMSPEEELDGYEPEPLG----------------------
Q8HYS5_MCL1-01          PEEMEGPAADAIMSPEEELDGYEPEPLG----------------------
M3XZZ5_MCL1-01          PEEMEGPAADAIMSPEEELDGYEPEPLG----------------------
A0A452RHX5_MCL1-01      PEEMEGPAADAIMSPEEELDGYEPEPLG----------------------
H0XFB7_MCL1-01          REEMEAPAADAIMSPEDELDGYEPEPLG----------------------
A0A2K6GI15_MCL1-02      SEEMEAPAADAIMSPEDELDGYEPEPLG----------------------
F7GTF7_MCL1-02          LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K5CFH3_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K6V5Y3_MCL1-01      LEEMEAPAADAIMSPEDELDGYEPEPLG----------------------
A0A2K6KRW9_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K6PPL1_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K5XSC7_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A0D9RZP5_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K5W0W9_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
I7G687_MCL1-01          LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
F7HUE9_MCL1-01          LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K6ECR0_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2I3M3D6_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K5LXU8_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2I3GB35_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
H2N5Y9_MCL1-01          LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
Q07820_MCL1-01          LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2R9BYH6_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
K7DE58_MCL1-01          LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2I2YQH7_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K5I9Q7_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
M3XAP4_MCL1-02          PEKMEGPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K6GI15_MCL1-01      SEEMEAPAADAIMSPEDELDGYEPEPLG----------------------
F7GTF7_MCL1-01          LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K5CFH3_MCL1-03      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K6V5Y3_MCL1-02      LEEMEAPAADAIMSPEDELDGYEPEPLG----------------------
A0A2K6KRW9_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K6PPL1_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K5LXU8_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K5W0W9_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K6ECR0_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2I3M3D6_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2K5XSC7_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2I3GB35_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
Q07820_MCL1-03          LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2R9BYH6_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
K7DE58_MCL1-02          LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
A0A2I2YQH7_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLG----------------------
G3WBC5_MCL1-01          PAEVADGAADAILSPEDELDGYEPELPG----------------------
W5QI41_MCL1-01          RKPRPAPGPAPALTPPVRCRAQPPEAFAAFPIYGMQIKRQQQWFKMFGFK
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          GGAGLGAGSGGATRPGGRLLATEKEASA----------------------
B4DG83_MCL1-01          ---MEAPAADAIMSPEEELDGYEPEPLG----------------------
B4E3L8_MCL1-01          ---MEAPAADAIMSPEEELDGYEPEPLG----------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
H2MLZ3_MCL1-01          --------------------------------------------------
H2MLZ3_MCL1-02          --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2T2A9_MCL1-02      --------------------------------------------------
A0A3Q2T2A9_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4R7_MCL1-02      --------------------------------------------------
A0A3P9Q4R7_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-02      --------------------------------------------------
A0A3P8VKS9_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-05      --------------------------------------------------
A0A3P8VKS9_MCL1-04      --------------------------------------------------
A0A3P8VKS9_MCL1-03      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3P8NP63_MCL1-03      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4E3I4_MCL1-03      --------------------------------------------------
A0A3B4E3I4_MCL1-02      --------------------------------------------------
A0A3B4E3I4_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-02      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0RA11_MCL1-03      --------------------------------------------------
A0A3Q0RA11_MCL1-01      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
                                                                          

A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          -------SLPCSQEDELDEDMDNGSQGSTSPPD-----------------
F7ETY1_MCL1-01          -------SLTASQEGELDEDIDGGSQGSSSPPD-----------------
H3AR18_MCL1-02          ---------------------ADGSVPPSPPTP-----------------
H3AR18_MCL1-01          -----------------------MELPGDGCPQ-----------------
J7H260_MCL1-01          ---------------------------STSPPL-----------------
H0XHA5_MCL1-01          KQPEGLPLLEFVGEAGNG--PSTDTLPSTPPPA-----------------
R4GAJ0_MCL1-01          EAATVPSSTPSPDKEMAEEEGEKGKGGPPLFP------------------
R4GAJ0_MCL1-02          EAATVPSSTPSPDKEMAEEEGEKGKGGPPLFP------------------
G1QAV8_MCL1-01          KQPAVLPLLQLVGEA--SEGPAGGSLPSTPPPA-----------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-03          --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSC7_MCL1-03      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      -----------------RGPGGD-SLPGTPPEL-----------------
A0A1L1RNM6_MCL1-02      -----------------RGPGGD-SLPGTPPEL-----------------
F6ZMX1_MCL1-01          KRPSRLAVLEIARE---GGDSPNGSLPSTPPP------------------
A0A286Y1M5_MCL1-01      KRPAVLPLLGLVGEAG-KSPSADGSLPSTPPP------------------
P97287_MCL1-02          KRPAVLPLLERVSEAA-KSSGADGSLPSTPPP------------------
P97287_MCL1-01          KRPAVLPLLERVSEAA-KSSGADGSLPSTPPP------------------
G3T756_MCL1-01          KRPAVFPRLGLVGEAS-NGPGTDGSLPSTPPL------------------
G1L3M8_MCL1-02          KRPAVLPLLELVGEAS-GGPCTDGSLPSTPPP------------------
A0A2U3V2H3_MCL1-01      KRPSVLPLLELVGEAS-NSPGKDGSLPSTPPP------------------
K9IWB2_MCL1-03          KRPAVLPLLGLVEEAS-SGPGTDGSLPSTPPP------------------
K9IWB2_MCL1-02          KRPAVLPLLGLVEEAS-SGPGTDGSLPSTPPP------------------
K9IWB2_MCL1-01          KRPAVLPLLGLVEEAS-SGPGTDGSLPSTPPP------------------
B4DU51_MCL1-01          KRPAVLPLLELVGESG-NNTSTDGSLPLTPPP------------------
A0A287DCH9_MCL1-02      KRPAVLPLLELVGEAA-KSPGADGSLPSTPPP------------------
A0A287DCH9_MCL1-01      KRPAVLPLLELVGEAA-KSPGADGSLPSTPPP------------------
A0A452GAH0_MCL1-02      KRPAVRPLALMVGEASNNSPGSDGSLPSTPPP------------------
A0A2K5I9Q7_MCL1-01      KRPAVLPLLELVGES--NSSSTDGSLPSTPPP------------------
G1PZ39_MCL1-01          KRPAVLPLVQLVGEASGG-PGAGGSLPSTPPPA-----------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          KRPAVLPLLELVGEASSG-PGMDGSLPSTPPPA-----------------
A0A2K5C7L5_MCL1-01      KRPAVLPLLELVEEPGND-SSTDGSLPSTPP-------------------
Q9Z1P3_MCL1-01          KRPAVLPLLERVSEAAKS-SGADGSLPSTPPPP-----------------
A5PJR2_MCL1-01          KRPAVRPLPLLVGEASNNSPGSDGSLPSTPPPA-----------------
A0A452GAH0_MCL1-01      KRPAVRPLALMVGEASNNSPGSDGSLPSTPPPS-----------------
G1L3M8_MCL1-01          KRPAVLPLLELVGEASGG-PCTDGSLPSTPPPA-----------------
F7AVA6_MCL1-01          KRPAVLPLLEFVREASSG-PCTDGSLPSTPPPA-----------------
G1T2Q0_MCL1-02          KRPAVLPLLDLVGEASKV-PSTDGSLPSTPPPA-----------------
G1T2Q0_MCL1-01          KRPAVLPLLDLVGEASKV-PSTDGSLPSTPPPA-----------------
M3XAP4_MCL1-01          KRPAVLPLLELVGEASSG-PGTDGSLPSTPPPA-----------------
Q7YRZ9_MCL1-01          KRPAVLPLLELVGEASSG-PGTDGSLPSTPPPA-----------------
J9PBC4_MCL1-02          KRPAVLPLLELVGEASSG-PGMDGSLPSTPPPA-----------------
Q8HYS5_MCL1-01          KRPAVLPLLELVGEASSG-PGMDGSLPSTPPPA-----------------
M3XZZ5_MCL1-01          KRPAVLPLLELVGEASSG-PCTDGSLPSTPPPA-----------------
A0A452RHX5_MCL1-01      KRPAVLPLLELVGEASGG-PCTDGSLPSTPPPA-----------------
H0XFB7_MCL1-01          KRPAVLPLLELVGEASNG-PSTDGSLPSTPPPA-----------------
A0A2K6GI15_MCL1-02      KRPAVLPLLELVGEASNG-SSTDGSLPSTPPPA-----------------
F7GTF7_MCL1-02          KRPAVLPLLELVGEPANG-SSTDGSLPSTPPPA-----------------
A0A2K5CFH3_MCL1-01      KRPAVLPLLELVGEPGNG-SSTDGSLPSTPPPA-----------------
A0A2K6V5Y3_MCL1-01      KRPAVLPLLELVGEPGHG-SSTDGSLPSTPPPA-----------------
A0A2K6KRW9_MCL1-01      KRPAVLPLLELVGESGNS-SSTDGSLPSTPPPA-----------------
A0A2K6PPL1_MCL1-01      KRPAVLPLLELVGESGNS-SSTDGSLPSTPPPA-----------------
A0A2K5XSC7_MCL1-01      KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
A0A0D9RZP5_MCL1-01      KRPAVLPLLELVGESGNS-SSTDGSLPSTPPPA-----------------
A0A2K5W0W9_MCL1-02      KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
I7G687_MCL1-01          KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
F7HUE9_MCL1-01          KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
A0A2K6ECR0_MCL1-01      KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
A0A2I3M3D6_MCL1-02      KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
A0A2K5LXU8_MCL1-01      KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
A0A2I3GB35_MCL1-02      KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPA-----------------
H2N5Y9_MCL1-01          KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPA-----------------
Q07820_MCL1-01          KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPA-----------------
A0A2R9BYH6_MCL1-01      KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPA-----------------
K7DE58_MCL1-01          KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPA-----------------
A0A2I2YQH7_MCL1-01      KRPAVLPLLELVGESGND-TSTDGSLPSTPPPA-----------------
A0A2K5I9Q7_MCL1-02      KRPAVLPLLELVGES-NS-SSTDGSLPSTPPPA-----------------
M3XAP4_MCL1-02          KRPAVLPLLELVGEASSG-PGTDGSLPSTPPPA-----------------
A0A2K6GI15_MCL1-01      KRPAVLPLLELVGEASNG-SSTDGSLPSTPPPA-----------------
F7GTF7_MCL1-01          KRPAVLPLLELVGEPANG-SSTDGSLPSTPPPA-----------------
A0A2K5CFH3_MCL1-03      KRPAVLPLLELVGEPGNG-SSTDGSLPSTPPPA-----------------
A0A2K6V5Y3_MCL1-02      KRPAVLPLLELVGEPGHG-SSTDGSLPSTPPPA-----------------
A0A2K6KRW9_MCL1-02      KRPAVLPLLELVGESGNS-SSTDGSLPSTPPPA-----------------
A0A2K6PPL1_MCL1-02      KRPAVLPLLELVGESGNS-SSTDGSLPSTPPPA-----------------
A0A2K5LXU8_MCL1-02      KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
A0A2K5W0W9_MCL1-01      KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
A0A2K6ECR0_MCL1-02      KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
A0A2I3M3D6_MCL1-01      KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
A0A2K5XSC7_MCL1-02      KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPA-----------------
A0A2I3GB35_MCL1-01      KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPA-----------------
Q07820_MCL1-03          KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPA-----------------
A0A2R9BYH6_MCL1-02      KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPA-----------------
K7DE58_MCL1-02          KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPA-----------------
A0A2I2YQH7_MCL1-02      KRPAVLPLLELVGESGND-TSTDGSLPSTPPPA-----------------
G3WBC5_MCL1-01          KRPARLAMLPLAREGGDTSSNARGSLPSTPPPA-----------------
W5QI41_MCL1-01          RRPAVRPLPLMVGEASNNSPGSDGSLPSTPPPS-----------------
F1MQX4_MCL1-01          --------------------------GMLPIFS-----------------
B4DLY8_MCL1-01          RRE--------IGGGEAGAV-IGGSAGASPPST-----------------
B4DG83_MCL1-01          KRPAVLPLLELVGESGNNTS-TDGSLPSTPPPA-----------------
B4E3L8_MCL1-01          KRPAVLPLLELVGESGNNTS-TDGSLPSTPPPA-----------------
G3PJT0_MCL1-01          YPSKPQRED---SED-----TDNDSLPCTPE-------------------
A0A3Q3VP02_MCL1-01      YMGKPIRKDS--TDT-----DDDGSLPYTPDMS-----------------
A0A3B5K5B3_MCL1-01      CVAKAIQEDS--QDT-----DHRSA-PCTPEMN-----------------
H2MLZ3_MCL1-01          YSARRF------HDV-----DDDGSLPNTPELE-----------------
H2MLZ3_MCL1-02          YSARRF------HDV-----DDDGSLPNTPELE-----------------
A0A3B3CEX1_MCL1-02      YAARRF------HD------DDGGSLPNTPELE-----------------
A0A3B3CEX1_MCL1-01      YAARRF------HD------DDGGSLPNTPELE-----------------
A0A3Q3B4V7_MCL1-01      YQDKRFQ-----ELG-----DDHGSLPSTPEVD-----------------
A0A3Q3B4V7_MCL1-02      YQDKRFQ-----ELG-----DDHGSLPSTPEVD-----------------
A0A3Q2EDX8_MCL1-01      YVGKNLSDN---SAD------DGGSLPCTPEMP-----------------
A0A3Q2T2A9_MCL1-02      FAVKSIQEN---RDD--------GSLPSTPEMQ-----------------
A0A3Q2T2A9_MCL1-01      FAVKSIQEN---RDD--------GSLPSTPEMQ-----------------
A0A3B5PQ55_MCL1-02      YVAKSLPTS---SDD-----SDEGSLPCTPAQH-----------------
A0A3B5PQ55_MCL1-01      YVAKSLPTS---SDD-----SDEGSLPCTPAQH-----------------
A0A3P9Q4R7_MCL1-02      YVAKSLPES---SDD-----SDEGSLPCTPAQQ-----------------
A0A3P9Q4R7_MCL1-01      YVAKSLPES---SDD-----SDEGSLPCTPAQQ-----------------
A0A087X830_MCL1-01      YVAKSLQKS---SDD-----SDEGSLPCTPAQQ-----------------
A0A3B3YCD0_MCL1-01      YVAKSLQKS---SDD-----SDEGSLPCTPAQQ-----------------
A0A3P8VKS9_MCL1-02      HARKS-------HCE-----VDEGSEPCTPEPH-----------------
A0A3P8VKS9_MCL1-01      HARKS-------HCE-----VDEGSEPCTPEPH-----------------
A0A3P8VKS9_MCL1-05      HARKS-------HCE-----VDEGSEPCTPEPH-----------------
A0A3P8VKS9_MCL1-04      HARKS-------HCE-----VDEGSEPCTPEPH-----------------
A0A3P8VKS9_MCL1-03      HARKS-------HCE-----VDEGSEPCTPEPH-----------------
I3JHR5_MCL1-01          YTTKAI------RDR-----EEDGSLPSTPEYH-----------------
A0A3Q4HLQ8_MCL1-01      YTTKAI------RDR-----EEDGSLPSTPEFH-----------------
A0A3P8NP63_MCL1-02      YKTKAI------RDR-----EEDGSLPSTPEFH-----------------
A0A3P8NP63_MCL1-03      YKTKAI------RDR-----EEDGSLPSTPEFH-----------------
A0A3Q2VNL8_MCL1-01      YKTKAI------RDR-----EEDGSLPSTPEFH-----------------
A0A3P8NP63_MCL1-01      YKTKAI------RDR-----EEDGSLPSTPEFH-----------------
A0A3P9BVM3_MCL1-01      YKTKAI------RDR-----EEDGSLPSTPEFH-----------------
A0A3B4G4Z6_MCL1-01      YKTKAI------RDR-----EEDGSLPSTPEFH-----------------
A0A2U9CJ81_MCL1-01      YAAKSCREDGGGGGD-----VGGGSLPSTPE-------------------
A0A3Q3IZW0_MCL1-01      YGTKTL-VD---VSD-----IDNGSLPCSPVLQ-----------------
A0A3Q1GX28_MCL1-02      YATKNIGAN---SDD-----IEDGSLPCTPELM-----------------
A0A3Q1GX28_MCL1-01      YATKNIGAN---SDD-----IEDGSLPCTPELM-----------------
A0A3B4XKA5_MCL1-01      YATKASRED----SD-----VDDGSLPCTPEMQ-----------------
A0A3Q3GP42_MCL1-01      -------------DD-----IEDGSLPCTPEPD-----------------
A0A3Q3M6G2_MCL1-02      YATKSIVAD---TDD-----IEDGSLPCTPELQ-----------------
A0A3Q3M6G2_MCL1-01      YATKSIVAD---TDD-----IEDGSLPCTPELQ-----------------
A0A3B1IEV7_MCL1-01      -------------VS-----MGGGSLPDSPL-------------------
A0A3B4E3I4_MCL1-03      ------------KAA-----MAGGSLPESPESDDFVPDF-----------
A0A3B4E3I4_MCL1-02      ------------SSS-----AQTGS-PAAPELTHVQVNSISISSTKEQTT
A0A3B4E3I4_MCL1-01      ------------SSS-----AQTGS-PAAPELTHVQVNSISISSTKEQTT
A0A3B4AFB7_MCL1-01      ------------DYE-----NSEGSLPCTPEFH-----------------
Q8UWD6_MCL1-01          ------------AVD-----SLQGSVPSSPS-------------------
F8W4Q8_MCL1-01          ------------AVD-----SLQGSVPSSPS-------------------
Q568W5_MCL1-01          ------------AVD-----SLQGSVPSSPS-------------------
A0A3B1K5R1_MCL1-01      ------------RPG-----VDDGSVPSSPL-------------------
A0A3B4C6H5_MCL1-01      ------------IAA-----VTDGSLPTSPA-------------------
A0A3B4C6H5_MCL1-02      ------------IAA-----VTDGSLPTSPA-------------------
A0A3B4C6H5_MCL1-03      ------------IAA-----VTDGSLPTSPA-------------------
Q568V1_MCL1-01          LQLDGRFVS-----------TTDGSLPTTPDPE-----------------
Q1L8X3_MCL1-01          LQLDGRFVS-----------ATDGSLPTTPDPE-----------------
Q9I9N3_MCL1-01          LQLDGRFVS-----------ATDGSLPTTPDPE-----------------
W5MMB7_MCL1-01          GHFPESG-------------HADGSLPSTPDTP-----------------
A0A3B3R4U0_MCL1-01      --------------------NEDGSLPSTPGTP-----------------
A0A3B3SG34_MCL1-01      EPCRGSRLP---GST-----NAVGSLPTSPDGD-----------------
A0A3Q2Y539_MCL1-01      --------------------MDEGAQP-LPELQ-----------------
Q4SW32_MCL1-01          CLSKTIQED-----------SEDGSLPCTPESH-----------------
D2ITA0_MCL1-03          RLVNKSQDD---QEG-------NGSLPSTPELQ-----------------
D2ITA0_MCL1-04          RLVNKSQDD---QEG-------NGSLPSTPELQ-----------------
Q0KFR9_MCL1-01          NGLDNHLSD---RSN-----N-DDSLPCTPQMA-----------------
A0A3P8Y1W8_MCL1-01      NVLDSRLSD---LAD-----DSDDSLPCTPLMV-----------------
A0A3P8Y1W8_MCL1-02      NVLDSRLSD---LAD-----DSDDSLPCTPLMV-----------------
A0A3Q2XZL8_MCL1-01      LATMNHRNN---SDDDFDVESSDDSPPSTPDSQ-----------------
A0A3B4AFB7_MCL1-02      LLNKNTREE---DYE-----NSEGSLPCTPEFH-----------------
A0A3B3VM25_MCL1-01      YVAKSLQES---SD--------EGSLPCTPA-Q-----------------
A0A3Q0RA11_MCL1-03      YAPKNI------TDD-----VEDGSLPSTPEFH-----------------
A0A3Q0RA11_MCL1-01      YAPKNI------TDD-----VEDGSLPSTPEFH-----------------
A0A3B4T8L9_MCL1-02      YATKASRED---SD------VDDGSLPCTPEIQ-----------------
A0A3B4T8L9_MCL1-01      YATKASRED---SD------VDDGSLPCTPEIQ-----------------
A0A3Q1EQB9_MCL1-02      YAPKSLRQD---SDS-----MEDGSLPCTPELQ-----------------
A0A3B4ZKP6_MCL1-01      FAGKGLRQV---SDS-----LEDSSLPCTPELQ-----------------
A0A3Q1BKL8_MCL1-02      YASKNLRQD---SDS-----MEEGSLPCTPELQ-----------------
A0A3Q1EQB9_MCL1-01      YAPKSLRQD---SDS-----MEDGSLPCTPELQ-----------------
A0A3Q1BKL8_MCL1-01      YASKNLRQD---SDS-----MEEGSLPCTPELQ-----------------
A0A3P8RQX7_MCL1-02      YASKNLRQD---SDS-----MEEGSLPCTPELQ-----------------
A0A3P8RQX7_MCL1-01      YASKNLRQD---SDS-----MEEGSLPCTPELQ-----------------
                                                                          

A0A3Q0RA11_MCL1-02      ----------------------MPERNGSAISTQLGLHPRIS--------
I3KXG5_MCL1-01          ----------------------LERETKLIIHSFLGDFTGLSQPQ-----
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      -----------------------------------------TGAK-----
A0A3P8V8T6_MCL1-01      ---------------VCLTLCTLENDTRQLICDFLKDFTTKSTQR-----
B6V6J0_MCL1-01          ----------SPVCPKD----GLYMDTQQLILAFYRVYS-----------
F7ETY1_MCL1-01          ----------SPVCPKD----GLYMDTQQLILAFFRGYC-----------
H3AR18_MCL1-02          ----------STPEDGDGDMAEFRKETLKLLRSYLCEVA---GCE-----
H3AR18_MCL1-01          ----------D----GDMA--EFRKETLKLLRSYLCEVA---GCE-----
J7H260_MCL1-01          ----------TPT--CSPD--PLHTETRALLHTFFREWA--GDAK-----
H0XHA5_MCL1-01          ---------------EEED--ELYWQSMEIISRYLWEQE--TGED-----
R4GAJ0_MCL1-01          ------------------D--HLRKTTLEVVGRYLREAADEAGSK-----
R4GAJ0_MCL1-02          ------------------D--HLRKTTLEVVGRYLREAADEAGSK-----
G1QAV8_MCL1-01          ----------EEEE-ELS--------LLEMIPQHLRERA--GARD-----
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------A--TGAK-----
A0A2K6GI15_MCL1-03      --------------------------------------A--TGAK-----
C8YZ26_MCL1-01          --------------------------------------A--TGAK-----
A0A2K5CFH3_MCL1-02      --------------------------------------A--TGAK-----
F7GTF7_MCL1-03          --------------------------------------A--TGAK-----
A0A2K6V5Y3_MCL1-03      --------------------------------------A--TGAK-----
A0A2K5LXU8_MCL1-03      --------------------------------------A--TGAK-----
A0A2K5I9Q7_MCL1-03      --------------------------------------A--TGAK-----
A0A2I2YQH7_MCL1-03      --------------------------------------A--TGAK-----
Q07820_MCL1-04          --------------------------------------A--TGAK-----
A0A2K5W0W9_MCL1-03      --------------------------------------A--TGAK-----
F7HUE9_MCL1-02          --------------------------------------A--TGAK-----
A0A2K6ECR0_MCL1-03      --------------------------------------A--TGAK-----
A0A2K5XSC7_MCL1-03      --------------------------------------A--TGAK-----
A0A2R9BYH6_MCL1-03      --------------------------------------A--TGAK-----
K7DE58_MCL1-03          --------------------------------------A--TGAK-----
A0A2I3M3D6_MCL1-03      --------------------------------------A--TGAK-----
A0A2K6KRW9_MCL1-03      --------------------------------------A--TGAK-----
A0A2K6PPL1_MCL1-03      --------------------------------------A--TGAK-----
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      ----------PDLI-PDE----LRQESLELILRYLREAA--GEAEPGVKK
A0A1L1RNM6_MCL1-02      ----------PDLI-PDE----LRQESLELILRYLREAA--GEAEPGVKK
F6ZMX1_MCL1-01          ----------AEED-EEED--ELYGQSLELISRYLREQA--VGTK-----
A0A286Y1M5_MCL1-01      ----------AEEE-EEED--ALYRQSLEIISRYLREQA--AGAK-----
P97287_MCL1-02          ----------PEEE-EDD----LYRQSLEIISRYLREQA--TGSK-----
P97287_MCL1-01          ----------PEEE-EDD----LYRQSLEIISRYLREQA--TGSK-----
G3T756_MCL1-01          ----------AEEE-EDE----LYRQSLEIISRYLQEQA--TGAK-----
G1L3M8_MCL1-02          ----------AEEE-EDE----LYRQSLEIISRYLREQA--TGAK-----
A0A2U3V2H3_MCL1-01      ----------AEEE-EDE----LYRQSLEIISRYLREQA--TGTK-----
K9IWB2_MCL1-03          ----------AEEE-EDE----LYRQSLEIISRYLREQA--TGAK-----
K9IWB2_MCL1-02          ----------AEEE-EDE----LYRQSLEIISRYLREQA--TGAK-----
K9IWB2_MCL1-01          ----------AEEE-EDE----LYRQSLEIISRYLREQA--TGAK-----
B4DU51_MCL1-01          ----------AEEE-EDE----LYRQSLEIISRYLREQA--TGAK-----
A0A287DCH9_MCL1-02      ----------AEEE-DDE----LYRQSLEIISRYLREQA--TGSK-----
A0A287DCH9_MCL1-01      ----------AEEE-DDE----LYRQSLEIISRYLREQA--TGSK-----
A0A452GAH0_MCL1-02      ----------SEEE-EDE----LYRQSLEIISQYLLEQA--TGAK-----
A0A2K5I9Q7_MCL1-01      ----------AEEE-EDE----LYRQSLEIISRYLREQA--TGAK-----
G1PZ39_MCL1-01          ----------E----EEED--ELFRQSLEIISRY-REQA--TGAK-----
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K5C7L5_MCL1-01      -------------------------TSLEIISRYLREQA--TGAK-----
Q9Z1P3_MCL1-01          ----------E----EEDD--ELYHQSLEIISRYLREQA--TGSK-----
A5PJR2_MCL1-01          ----------E----EEED--ELYRQSLEIISQYLREQA--TGAK-----
A0A452GAH0_MCL1-01      ----------E----EEED--ELYRQSLEIISQYLLEQA--TGAK-----
G1L3M8_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
F7AVA6_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGTK-----
G1T2Q0_MCL1-02          ----------E----EEED--ELYRQSLEIIARYLREQA--TGAK-----
G1T2Q0_MCL1-01          ----------E----EEED--ELYRQSLEIIARYLREQA--TGAK-----
M3XAP4_MCL1-01          ----------E----EEED--ELFRQSLEIISRYLREQA--TGAK-----
Q7YRZ9_MCL1-01          ----------E----EEED--ELFRQSLEIISRYLREQA--TGAK-----
J9PBC4_MCL1-02          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
Q8HYS5_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
M3XZZ5_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A452RHX5_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
H0XFB7_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K6GI15_MCL1-02      ----------E----EEDD--ELYRQSLEIISRYLREQA--TGAK-----
F7GTF7_MCL1-02          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K5CFH3_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K6V5Y3_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K6KRW9_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K6PPL1_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K5XSC7_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A0D9RZP5_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K5W0W9_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
I7G687_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
F7HUE9_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K6ECR0_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2I3M3D6_MCL1-02      ----------E----EEED--ELYRQSLEIISWYLREQA--TGAK-----
A0A2K5LXU8_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2I3GB35_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
H2N5Y9_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
Q07820_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2R9BYH6_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
K7DE58_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2I2YQH7_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K5I9Q7_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
M3XAP4_MCL1-02          ----------E----EEED--ELFRQSLEIISRYLREQA--TGAK-----
A0A2K6GI15_MCL1-01      ----------E----EEDD--ELYRQSLEIISRYLREQA--TGAK-----
F7GTF7_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K5CFH3_MCL1-03      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K6V5Y3_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K6KRW9_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K6PPL1_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K5LXU8_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K5W0W9_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2K6ECR0_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2I3M3D6_MCL1-01      ----------E----EEED--ELYRQSLEIISWYLREQA--TGAK-----
A0A2K5XSC7_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2I3GB35_MCL1-01      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
Q07820_MCL1-03          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2R9BYH6_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
K7DE58_MCL1-02          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
A0A2I2YQH7_MCL1-02      ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
G3WBC5_MCL1-01          ----------EEDEDEEED--ELYGQSLELITRYLREQA--VGTK-----
W5QI41_MCL1-01          ----------E----EEED--ELYRQSLEIISQYLLEQA--TGTK-----
F1MQX4_MCL1-01          ----------E----EEED--ELYWQSLEIISRYLREQA--TGAK-----
B4DLY8_MCL1-01          ----------L----TPDS--R-------------RVAR--PPPK-----
B4DG83_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
B4E3L8_MCL1-01          ----------E----EEED--ELYRQSLEIISRYLREQA--TGAK-----
G3PJT0_MCL1-01          -----SDSETDVSDSPAGAA-ALESDTRQLLGRFLREFTGLSKTQ-----
A0A3Q3VP02_MCL1-01      -----PDSELNVSGCLAGDE-LLEKDTRQLISRVLMELSGHGRAR-----
A0A3B5K5B3_MCL1-01      -----SVNGLDVSGRPAEDEAALDNDTRQLLSCFMADFCGIGSHQ-----
H2MLZ3_MCL1-01          -----CEASVS--GDNSGID-ALNEDTTEFLTNFFRNFVGISQYR-----
H2MLZ3_MCL1-02          -----CEASVS--GDNSGID-ALNEDTTEFLTNFFRNFVGISQYR-----
A0A3B3CEX1_MCL1-02      -----CDNSVL--VPND--P-PINQDTTEFLTNFFRNYVGLSQSR-----
A0A3B3CEX1_MCL1-01      -----CDNSVL--VPND--P-PINQDTTEFLTNFFRNYVGLSQSR-----
A0A3Q3B4V7_MCL1-01      -----GNPDVP---GGAEDE-VLENDTKHLISRFLQEFTGLSKRQ-----
A0A3Q3B4V7_MCL1-02      -----GNPDVP---GGAEDE-VLENDTKHLISRFLQEFTGLSKRQ-----
A0A3Q2EDX8_MCL1-01      -----TDSHPATPGGHAGDE-ALDNDTKELISSFLRDFTGLPKQR-----
A0A3Q2T2A9_MCL1-02      -----ADSEAAGCGSHAGQE-ALDSDTTELISGFLRDFTGLSGHR-----
A0A3Q2T2A9_MCL1-01      -----ADSEAAGCGSHAGQE-ALDSDTTELISGFLRDFTGLSGHR-----
A0A3B5PQ55_MCL1-02      -----PDSEKDATAVGASNQ-VLDNDTTELISSFLRDFTGLSKCR-----
A0A3B5PQ55_MCL1-01      -----PDSEKDATAVGASNQ-VLDNDTTELISSFLRDFTGLSKCR-----
A0A3P9Q4R7_MCL1-02      ------DGETDASAVRASNQ-VLDNDTTELISSFLRNFTGLSKCR-----
A0A3P9Q4R7_MCL1-01      ------DGETDASAVRASNQ-VLDNDTTELISSFLRNFTGLSKCR-----
A0A087X830_MCL1-01      ------DSETDASAVRASNQ-VLDNDTMELISSFLRNFTGLSKCR-----
A0A3B3YCD0_MCL1-01      ------DSETDASAVRASNQ-VLDNDTMELISSFLRHFTGLSKCR-----
A0A3P8VKS9_MCL1-02      -----SEAELD--VSQAGDE-VLDTDTKELIFQFYRDFTTHSPSK-----
A0A3P8VKS9_MCL1-01      -----SEAELD--VSQAGDE-VLDTDTKELIFQFYRDFTTHSPSK-----
A0A3P8VKS9_MCL1-05      -----SEAELD--VSQAGDE-VLDTDTKELIFQFYRDFTTHSPSK-----
A0A3P8VKS9_MCL1-04      -----SEAELD--VSQAGDE-VLDTDTKELIFQFYRDFTTHSPSK-----
A0A3P8VKS9_MCL1-03      -----SEAELD--VSQAGDE-VLDTDTKELIFQFYRDFTTHSPSK-----
I3JHR5_MCL1-01          -----LDGESD--------E-ELERETKLLIHSFLGDFTGLSQPQ-----
A0A3Q4HLQ8_MCL1-01      -----SDSESD--------E-QLERETKLLIHSFLGDFTGLSQPQ-----
A0A3P8NP63_MCL1-02      -----SDSESD--------E-QLERETKLLIHSFLGDFIGLSQPQ-----
A0A3P8NP63_MCL1-03      -----SDSESD--------E-QLERETKLLIHSFLGDFIGLSQPQ-----
A0A3Q2VNL8_MCL1-01      -----SDSESD--------E-QLERETKLLIHSFLGDFTGLSQPQ-----
A0A3P8NP63_MCL1-01      -----SDSESD--------E-QLERETKLLIHSFLGDFIGLSQPQ-----
A0A3P9BVM3_MCL1-01      -----SDSESD--------E-QLERETKLLIHSFLGDFIGLSQPQ-----
A0A3B4G4Z6_MCL1-01      -----SDSESD--------E-QLERETKLLIHSFLGDFTGLSQPQ-----
A0A2U9CJ81_MCL1-01      -----SDGEHDVSGCPAADE-ALDSFTRELISQFLRDYVARTDPR-----
A0A3Q3IZW0_MCL1-01      -----PDNEIEVSSSPAEYE-VLENDTRLLICHFLRDYTGLSTHR-----
A0A3Q1GX28_MCL1-02      -----SDSEVDVSSCPAGDE-VLENDTRQLLSQFLQDFSGLTKPR-----
A0A3Q1GX28_MCL1-01      -----SDSEVDVSSCPAGDE-VLENDTRQLLSQFLQDFSGLTKPR-----
A0A3B4XKA5_MCL1-01      -----SDGETDVPSCPAG-E-VLESDTSQLISQSMKSFTGRSIQR-----
A0A3Q3GP42_MCL1-01      -----SE--TEVSSCPTGGE-VLESDTRQLISAFLREHTGLSKPG-----
A0A3Q3M6G2_MCL1-02      -----SD--SEAPSCPAGDE-VLENDTRQLICQYLKDVSGLSKPR-----
A0A3Q3M6G2_MCL1-01      -----SD--SEAPSCPAGDE-VLENDTRQLICQYLKDVSGLSKPR-----
A0A3B1IEV7_MCL1-01      -----ADVDFIQDFSCRCPG-ALEAETRRLMVEFYRGYLG--QKP-----
A0A3B4E3I4_MCL1-03      -----------------GGS-ALVEETRRLIGGFYRGYIG--QKT-----
A0A3B4E3I4_MCL1-02      ISLCDGEVTVLIKPKPKGRV-RLEEETLCIIGDFYQGY-----RS-----
A0A3B4E3I4_MCL1-01      ISLCDGEVTVLIKPKPKGRV-RLEEETLCIIGDFYQGY-----RS-----
A0A3B4AFB7_MCL1-01      -----SDSEMELSSYSAEHE-VLESDTRQLLSDFFKLFTGISQPK-----
Q8UWD6_MCL1-01          -----DETGDYPP------T-ALDMDTREIIDTFLKIFTGLPHSK-----
F8W4Q8_MCL1-01          -----DETGDYPP------T-ALDMDTREIIDTFLKIFTGLPHSK-----
Q568W5_MCL1-01          -----DETGDYPP------T-ALDMDTREIIDTFLIIFTGLPHSK-----
A0A3B1K5R1_MCL1-01      -----SDCGEMAVGNCKQYE-TLDGDTREIISDFLRNFCGLSRSC-----
A0A3B4C6H5_MCL1-01      -----SDCEELDSDQFKESE-TLDRDTSEIVIDFLQNFTGLSRSC-----
A0A3B4C6H5_MCL1-02      -----SDCEELDSDQFKESE-TLDRDTSEIVIDFLQNFTGLSRSC-----
A0A3B4C6H5_MCL1-03      -----SDCEELDSDQFKESE-TLDRDTSEIVIDFLQNFTGLSRSC-----
Q568V1_MCL1-01          -----ELDYA-----------ELERDTRQLLLDFYRTHTGMCPVD-----
Q1L8X3_MCL1-01          -----ELDYA-----------ELERDTRQLLLDFYRTHTGMCPVD-----
Q9I9N3_MCL1-01          -----ELDYA-----------ELERDTRQLLLDFYRTHTGMCPVD-----
W5MMB7_MCL1-01          -----LDCGSVPEFLSEAHG-QLNAETRELIGTFLQMYTGLPHRR-----
A0A3B3R4U0_MCL1-01      -----PDCGKMLTFPNRG----LSQETHELIGTFLRTYSGLPASA-----
A0A3B3SG34_MCL1-01      -----LPAYGPICGFSRSAVEMLDQETSELITTFFAEYTGLCATL-----
A0A3Q2Y539_MCL1-01      -----T---------PPGQG-VLDTETRRLIGRFLRDFTGLSTAA-----
Q4SW32_MCL1-01          -----SGDVLDVSGRPAGDEAALDSDTRQLVSRLMADVTGISRAQ-----
D2ITA0_MCL1-03          -----SEVDTD---SQAGEE-VLDNDTKRIIRIFLRDYAGASKAK-----
D2ITA0_MCL1-04          -----SEVDTD---SQAGEE-VLDNDTKRIIRIFLRDYAGASKAK-----
Q0KFR9_MCL1-01          -----SECGPELSNCPSGDE-VLEHDTRQLIENFLGDYTGLSQPR-----
A0A3P8Y1W8_MCL1-01      -----TECSAGLSHCPSGNE-VLDNDTRQLIENLLRDYTGLSQPR-----
A0A3P8Y1W8_MCL1-02      -----TECSAGLSHCPSGNE-VLDNDTRQLIENLLRDYTGLSQPR-----
A0A3Q2XZL8_MCL1-01      -----DSLVAD-----GRND-VVDAETKGLIRRFLTDFTGLSTAS-----
A0A3B4AFB7_MCL1-02      -----SDSEMELSSYSAEHE-VLESDTRQLLSDFFKLFTGISQPK-----
A0A3B3VM25_MCL1-01      -----QDSETVASAVRASNQ-VLDNDTMELIGSFLRNFTGLSKCR-----
A0A3Q0RA11_MCL1-03      -----SDSES--------DE-ALERETKSLITSFFRDFTGLSQRR-----
A0A3Q0RA11_MCL1-01      -----SDSES--------DE-ALERETKSLITSFFRDFTGLSQRR-----
A0A3B4T8L9_MCL1-02      -----SDGETDVPSCPAGDE-VLEDDTRQLISQSMKSFTGRSIPR-----
A0A3B4T8L9_MCL1-01      -----SDGETDVPSCPAGDE-VLEDDTRQLISQSMKSFTGRSIPR-----
A0A3Q1EQB9_MCL1-02      -----SDSETDVSSCPTGDE-LLENDTRQLIRRFLRDFTGLSKPR-----
A0A3B4ZKP6_MCL1-01      -----SDSETDVSSCPAGDE-VLENDTRQLISSFLKDFTGLSKPR-----
A0A3Q1BKL8_MCL1-02      -----SDSETDVSSCPAGDE-LLENDTRQLLRRFLRDFTGLSKPR-----
A0A3Q1EQB9_MCL1-01      -----SDSETDVSSCPTGDE-LLENDTRQLIRRFLRDFTGLSKPR-----
A0A3Q1BKL8_MCL1-01      -----SDSETDVSSCPAGDE-LLENDTRQLLRRFLRDFTGLSKPR-----
A0A3P8RQX7_MCL1-02      -----SDSETDVSSCPAGDE-LLENDTRQLLRRFLRDFTGLSKPR-----
A0A3P8RQX7_MCL1-01      -----SDSETDVSSCPAGDE-LLENDTRQLLRRFLRDFTGLSKPR-----
                                                                          

A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------RKET---------------------KALK-MMKRVVADVLEK
U3KKY6_MCL1-01          ------------------------------------------------KK
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          ---------------------------------MILW-------------
A0A2K5DMS4_MCL1-01      --------DTKP-------MGRSEAANS-----KALE-TLRGVGEGVPRN
A0A3P8V8T6_MCL1-01      --------LVES---------------------KALS-TMKRVVKGILDK
B6V6J0_MCL1-01          --------GEESGELEASCLLQHGVHH------KALE-TLLRVGGEIIEK
F7ETY1_MCL1-01          --------GEETSGLKASFLLHHGAHP------KALE-TLQRVGGDIIEK
H3AR18_MCL1-02          --------STETAFRFGLDQWSGGE--------KPLD-TLRRVGDSIIDK
H3AR18_MCL1-01          --------STETAFRFGLDQWSGGE--------KPLD-TLRRVGDSIIDK
J7H260_MCL1-01          -----QEDGDSP---------------------KALP-TMRRLGGDINEK
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          --------GTGPKFSFQGLLGRFGSSPNEAEVARALE-TLRRVGESLREK
R4GAJ0_MCL1-02          --------GTGPKFSFQGLLGRFGSSPNEAEVARALE-TLRRVGESLREK
G1QAV8_MCL1-01          -----------------------QSQGP-----RVGG-VQRRAAGCSGVR
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------DAKP-------LGGSGAASR-----KALE-TLRRVGDGVQRN
A0A2K6GI15_MCL1-03      --------DAKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
C8YZ26_MCL1-01          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5CFH3_MCL1-02      --------DTKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
F7GTF7_MCL1-03          --------DTKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
A0A2K6V5Y3_MCL1-03      --------DTKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
A0A2K5LXU8_MCL1-03      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5I9Q7_MCL1-03      --------DTQP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2I2YQH7_MCL1-03      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
Q07820_MCL1-04          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5W0W9_MCL1-03      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
F7HUE9_MCL1-02          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K6ECR0_MCL1-03      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5XSC7_MCL1-03      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2R9BYH6_MCL1-03      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
K7DE58_MCL1-03          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2I3M3D6_MCL1-03      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K6KRW9_MCL1-03      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K6PPL1_MCL1-03      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      LFPGLLGGPGRP-------GRASSAVME-----KALE-TLRRVGDGVMQK
A0A1L1RNM6_MCL1-02      LFPGLLGGPGRP-------GRASSAVME-----KALE-TLRRVGDGVMQK
F6ZMX1_MCL1-01          --------EAKP-------LR-----SG-----KALE-TLRRVGDGVQRN
A0A286Y1M5_MCL1-01      --------DSKP-------LGGVGPTSR-----KALE-TLRRVGDGVQRN
P97287_MCL1-02          --------DSKP-------LGEAGAAGR-----RALE-TLRRVGDGVQRN
P97287_MCL1-01          --------DSKP-------LGEAGAAGR-----RALE-TLRRVGDGVQRN
G3T756_MCL1-01          --------DTKP-------MGGSGAASR-----KALE-TLRRVADGVQRN
G1L3M8_MCL1-02          --------DAKP-------LGGSGAASR-----KALE-TLRRVGDGVQRN
A0A2U3V2H3_MCL1-01      --------DAKP-------LGGSGAASR-----KALE-TLRRVGDGVQRN
K9IWB2_MCL1-03          --------DAKP-------MGGSGAASR-----KALE-TLRRVGDGVQRN
K9IWB2_MCL1-02          --------DAKP-------MGGSGAASR-----KALE-TLRRVGDGVQRN
K9IWB2_MCL1-01          --------DAKP-------MGGSGAASR-----KALE-TLRRVGDGVQRN
B4DU51_MCL1-01          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A287DCH9_MCL1-02      --------DAKP-------LRGSGAASR-----KALE-TLRRVGDGVQRN
A0A287DCH9_MCL1-01      --------DAKP-------LRGSGAASR-----KALE-TLRRVGDGVQRN
A0A452GAH0_MCL1-02      --------DAKP-------LGGSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5I9Q7_MCL1-01      --------DTQP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
G1PZ39_MCL1-01          --------DAKP-------LGGPAASSR-----KALE-TLRRVGDGVQRN
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          --------DAKP-------LGGSRAASR-----KALE-TLRRVGDGVQRN
A0A2K5C7L5_MCL1-01      --------DTKP-------MDRSGAASR-----KALE-TLRRVGDGVQRN
Q9Z1P3_MCL1-01          --------DAKP-------LGEAGAAGR-----RALE-TLRRVGDGVQRN
A5PJR2_MCL1-01          --------DAKP-------LGGSGTTSR-----KALE-TLRRVGDGVQRN
A0A452GAH0_MCL1-01      --------DAKP-------LGGSGATSR-----KALE-TLRRVGDGVQRN
G1L3M8_MCL1-01          --------DAKP-------LGGSGAASR-----KALE-TLRRVGDGVQRN
F7AVA6_MCL1-01          --------DTKP-------MGGSGAASR-----KALE-TLRRVGDGVQRN
G1T2Q0_MCL1-02          --------DAKP-------MGRAGSASR-----KALE-TLRRVGDGVQRN
G1T2Q0_MCL1-01          --------DAKP-------MGRAGSASR-----KALE-TLRRVGDGVQRN
M3XAP4_MCL1-01          --------DAKP-------LGGSGAASR-----KALE-TLRRVGDGVQRN
Q7YRZ9_MCL1-01          --------DAKP-------LGGSGAASR-----KALE-TLRRVGDGVQRN
J9PBC4_MCL1-02          --------DAKP-------LGGSRAASR-----KALE-TLRRVGDGVQRN
Q8HYS5_MCL1-01          --------DAKP-------LGGSRAASR-----KALE-TLQRVGDGVQRN
M3XZZ5_MCL1-01          --------DAKP-------LGGPGAASR-----KALE-TLRRVGDGVQRN
A0A452RHX5_MCL1-01      --------DAKP-------LGGSGAASR-----KALE-TLRRVGDGVQRN
H0XFB7_MCL1-01          --------DAKP-------MGRAGAASR-----KALE-TLRRVGDGVQRN
A0A2K6GI15_MCL1-02      --------DAKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
F7GTF7_MCL1-02          --------DTKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
A0A2K5CFH3_MCL1-01      --------DTKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
A0A2K6V5Y3_MCL1-01      --------DTKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
A0A2K6KRW9_MCL1-01      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K6PPL1_MCL1-01      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5XSC7_MCL1-01      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A0D9RZP5_MCL1-01      --------DTKP-------MSRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5W0W9_MCL1-02      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
I7G687_MCL1-01          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
F7HUE9_MCL1-01          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K6ECR0_MCL1-01      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2I3M3D6_MCL1-02      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5LXU8_MCL1-01      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2I3GB35_MCL1-02      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
H2N5Y9_MCL1-01          --------DTKP-------LGRSGATCR-----KALE-TLRRVGDGVQRN
Q07820_MCL1-01          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2R9BYH6_MCL1-01      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
K7DE58_MCL1-01          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2I2YQH7_MCL1-01      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5I9Q7_MCL1-02      --------DTQP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
M3XAP4_MCL1-02          --------DAKP-------LGGSGAASR-----KALE-TLRRVGDGVQRN
A0A2K6GI15_MCL1-01      --------DAKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
F7GTF7_MCL1-01          --------DTKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
A0A2K5CFH3_MCL1-03      --------DTKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
A0A2K6V5Y3_MCL1-02      --------DTKP-------MGRSGAASR-----KALE-TLRRVGDGVQRN
A0A2K6KRW9_MCL1-02      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K6PPL1_MCL1-02      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5LXU8_MCL1-02      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5W0W9_MCL1-01      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K6ECR0_MCL1-02      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2I3M3D6_MCL1-01      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2K5XSC7_MCL1-02      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2I3GB35_MCL1-01      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
Q07820_MCL1-03          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2R9BYH6_MCL1-02      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
K7DE58_MCL1-02          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
A0A2I2YQH7_MCL1-02      --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
G3WBC5_MCL1-01          --------DTKP-------L-----RSG-----KALE-TLRRVGDGVQRN
W5QI41_MCL1-01          --------DAKP-------LGGSGATSR-----KALE-TLRRVGDGVQRN
F1MQX4_MCL1-01          --------DVKP-------LGGSGATSR-----KALE-TLHRVGDGVQHN
B4DLY8_MCL1-01          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
B4DG83_MCL1-01          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
B4E3L8_MCL1-01          --------DTKP-------MGRSGATSR-----KALE-TLRRVGDGVQRN
G3PJT0_MCL1-01          --------WNPS---------------------RELT-TMKRVVGDVLEK
A0A3Q3VP02_MCL1-01      --------WTES---------------------RTLS-TMKRVVAELLEK
A0A3B5K5B3_MCL1-01      --------WRES---------------------GALS-TMKRVVANLMEK
H2MLZ3_MCL1-01          --------HRDN---------------------KYMS-TAKRVVNDVLEK
H2MLZ3_MCL1-02          --------HRDN---------------------KYMS-TAKRVVNDVLEK
A0A3B3CEX1_MCL1-02      --------HRES---------------------KYIS-TAKRVVNDMMDK
A0A3B3CEX1_MCL1-01      --------HRES---------------------KYIS-TAKRVVNDMMDK
A0A3Q3B4V7_MCL1-01      --------WSES---------------------KELS-TMNRVVEDLLTK
A0A3Q3B4V7_MCL1-02      --------WSES---------------------KELS-TMNRVVEDLLTK
A0A3Q2EDX8_MCL1-01      --------RNQT---------------------KALS-TMKRVVEDVLSK
A0A3Q2T2A9_MCL1-02      --------WYTK---------------------KSLS-TMKRVVEDLLSK
A0A3Q2T2A9_MCL1-01      --------WYTK---------------------KSLS-TMKRVVEDLLSK
A0A3B5PQ55_MCL1-02      --------WGQN---------------------KALS-TMKRVVEDLLSK
A0A3B5PQ55_MCL1-01      --------WGQN---------------------KALS-TMKRVVEDLLSK
A0A3P9Q4R7_MCL1-02      --------WSQN---------------------KALS-TMKRVVEDVLSK
A0A3P9Q4R7_MCL1-01      --------WSQN---------------------KALS-TMKRVVEDVLSK
A0A087X830_MCL1-01      --------WSQN---------------------KALS-TMKRVVEDVLSK
A0A3B3YCD0_MCL1-01      --------WSQN---------------------KALS-TMKRVVEDVLSK
A0A3P8VKS9_MCL1-02      --------WGER---------------------KALT-TMKRVVDDVLEK
A0A3P8VKS9_MCL1-01      --------WGER---------------------KALT-TMKRVVDDVLEK
A0A3P8VKS9_MCL1-05      --------WGER---------------------KALT-TMKRVVDDVLEK
A0A3P8VKS9_MCL1-04      --------WGER---------------------KALT-TMKRVVDDVLEK
A0A3P8VKS9_MCL1-03      --------WGER---------------------KALT-TMKRVVDDVLEK
I3JHR5_MCL1-01          --------RKET---------------------KALK-TMKRVVADVLEK
A0A3Q4HLQ8_MCL1-01      --------RKET---------------------KALK-TMKRVVADVLEK
A0A3P8NP63_MCL1-02      --------RKET---------------------KALK-TMKRVVADVLEK
A0A3P8NP63_MCL1-03      --------RKET---------------------KALK-TMKRVVADVLEK
A0A3Q2VNL8_MCL1-01      --------RKET---------------------KALK-TMKRVVADVLEK
A0A3P8NP63_MCL1-01      --------RKET---------------------KALK-TMKRVVADVLEK
A0A3P9BVM3_MCL1-01      --------RKET---------------------KALK-TMKRVVADVLEK
A0A3B4G4Z6_MCL1-01      --------RKET---------------------KALK-TMKRVVADVLEK
A0A2U9CJ81_MCL1-01      --------WTDS---------------------KALS-TMKRVVDRLVEK
A0A3Q3IZW0_MCL1-01      --------WTRR---------------------KTLS-TMKRVVEGVLEK
A0A3Q1GX28_MCL1-02      --------WCET---------------------KELS-TMKRVVNDVLEK
A0A3Q1GX28_MCL1-01      --------WCET---------------------KELS-TMKRVVNDVLEK
A0A3B4XKA5_MCL1-01      --------RTEH---------------------RALQ-TMKRVVEGVLEK
A0A3Q3GP42_MCL1-01      --------WNES---------------------SALS-TMKRVVEDVLAK
A0A3Q3M6G2_MCL1-02      --------WHDS---------------------KALS-TMKRVVEDLLEK
A0A3Q3M6G2_MCL1-01      --------WHDS---------------------KALS-TMKRVVEDLLEK
A0A3B1IEV7_MCL1-01      --------REQS---------------------PALR-TMSRVVAGVVLK
A0A3B4E3I4_MCL1-03      --------RDQH---------------------PAHG-TMSRVVEGVILK
A0A3B4E3I4_MCL1-02      --------RNQH---------------------PASD-TLSRVVEGMLHK
A0A3B4E3I4_MCL1-01      --------RNQH---------------------PASD-TLSRVVEGMLHK
A0A3B4AFB7_MCL1-01      --------WKQR---------------------PALS-TMKGVVDKLLEK
Q8UWD6_MCL1-01          --------SGRK---------------------QVLS-TMRRVVDNLAVK
F8W4Q8_MCL1-01          --------SGRK---------------------QVLS-TMRRVVDNLAVK
Q568W5_MCL1-01          --------SGRK---------------------QVLS-TMRRVVDNLAVK
A0A3B1K5R1_MCL1-01      --------GGHG---------------------AVVQ-TMKRVVDDLVVK
A0A3B4C6H5_MCL1-01      --------GRHR---------------------GVVQ-TIRRVVDGLVVK
A0A3B4C6H5_MCL1-02      --------GRHR---------------------GVVQ-TIRRVVDGLVVK
A0A3B4C6H5_MCL1-03      --------GRHR---------------------GVVQ-TIRRVVDGLVVK
Q568V1_MCL1-01          --------RKLH---------------------HAIP-TMKRVVDNILVK
Q1L8X3_MCL1-01          --------RKLH---------------------HAIP-TMKRVVDNILVK
Q9I9N3_MCL1-01          --------RKLH---------------------HAIP-TMKRVVDNILVK
W5MMB7_MCL1-01          ---------SRG---------------------KALE-TLKRVVDSVVAK
A0A3B3R4U0_MCL1-01      ---------SRH---------------------KAYP-VLRRVAETVIGK
A0A3B3SG34_MCL1-01      --------QRRN---------------------EALS-TLKRVVATVVEK
A0A3Q2Y539_MCL1-01      --------WIQS---------------------KAQS-TMKRVVTRLVDK
Q4SW32_MCL1-01          --------WRES---------------------RALA-TTKRVVGDLMEK
D2ITA0_MCL1-03          --------RTRQ---------------------DEVQVTMRRVVDGVLEK
D2ITA0_MCL1-04          --------RTRQ---------------------DEVQVTMRRVVDGVLEK
Q0KFR9_MCL1-01          --------WTQS---------------------KPLT-TMKRVVEDVIAK
A0A3P8Y1W8_MCL1-01      --------WKQN---------------------KSLV-TMKRVVGDVIAK
A0A3P8Y1W8_MCL1-02      --------WKQN---------------------KSLV-TMKRVVGDVIAK
A0A3Q2XZL8_MCL1-01      --------WNES---------------------KAHS-TMKRVVAKVLEK
A0A3B4AFB7_MCL1-02      --------WKQR---------------------PALS-TMKGVVDKLLEK
A0A3B3VM25_MCL1-01      --------WSQN---------------------KALS-TMKRVVEDVLSK
A0A3Q0RA11_MCL1-03      --------WKES---------------------EALK-TMKRVVADVLEK
A0A3Q0RA11_MCL1-01      --------WKES---------------------EALK-TMKRVVADVLEK
A0A3B4T8L9_MCL1-02      --------WTEH---------------------RALQ-TMKRVVDGVLEK
A0A3B4T8L9_MCL1-01      --------WTEH---------------------RALQ-TMKRVVDGVLEK
A0A3Q1EQB9_MCL1-02      --------WNES---------------------KALS-TMKRVVDDVLDK
A0A3B4ZKP6_MCL1-01      --------WNEG---------------------KALS-TMKRVVEDVLEK
A0A3Q1BKL8_MCL1-02      --------WNES---------------------KALS-TMKRVVDDVLDK
A0A3Q1EQB9_MCL1-01      --------WNES---------------------KALS-TMKRVVDDVLDK
A0A3Q1BKL8_MCL1-01      --------WNES---------------------KALS-TMKRVVDDVLDK
A0A3P8RQX7_MCL1-02      --------WNES---------------------KALS-TMKRVVDDVLDK
A0A3P8RQX7_MCL1-01      --------WNES---------------------KALS-TMKRVVDDVLDK
                                                                          

A0A3Q0RA11_MCL1-02      ------GMVNKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGA
I3KXG5_MCL1-01          HRYAYNGMINKLSLDEREEDMSF---VAKSLFGDHTTNWGRIVSFVAFGA
U3KKY6_MCL1-01          NKKNLPGMLRKLEIQQEE-DLQSVVEVAAHVFSDGVTNWGRVVTLIAFGA
G1MPY7_MCL1-01          ----FSGMLRKLEIKKEE-DLQAVCEVAAHVFSDGVTNWGRVVTLISFGA
K7FPN7_MCL1-01          ------GMLRKLDIKNEE-DLKSVSSVATHVFSDGITNWGRIVTLISFGA
F8W4Q8_MCL1-02          ---TLSGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGA
A0A2K5DMS4_MCL1-01      HEMALQGMLRNLDNKNED-NVKSFY---------GVTNWGRIVTLSSFGA
A0A3P8V8T6_MCL1-01      HRHAFSGMINNLSFENGVYNIGVVGAVARSLFRDGTSNWGRIVSLVAFGA
B6V6J0_MCL1-01          HHMAFTGMLQRLSIHSRE-DLQKLSEVPALVFNDGVTNWGRIVTVISFGA
F7ETY1_MCL1-01          HHMAFTGMLQRLSIHSRE-DLQKLSEVPALVFNDGVTNWGRIVTVISFGA
H3AR18_MCL1-02          HRIAFNGMQQKLNIHKED-DLHIIPEIGNQIFKDGATNWGRIVSLIAFGA
H3AR18_MCL1-01          HRIAFNGMQQKLNIHKED-DLHIIPEIGNQIFKDGATNWGRIVSLIAFGA
J7H260_MCL1-01          HRMAFQGMLQKLSIQRPE-DIQKLSEVPSMVFSDGVTNWGRIVTVISFGA
H0XHA5_MCL1-01          --------------------INSLSRVMAHVFSYGVTNWGRIMTLI-FGG
R4GAJ0_MCL1-01          HLLAFQGMLRKLEIKKEE-DLASVAEVTTEVFRDGIINWGRIVTLISFGA
R4GAJ0_MCL1-02          HLLAFQGMLRKLEIKKEE-DLASVAEVTTEVFRDGIINWGRIVTLISFGA
G1QAV8_MCL1-01          QETAFLGML-ELDTENED-NVKSSSQAMVHAFRDGVTN-GRIVTHFFWC-
A0A2K6F6N9_MCL1-01      ---AFQGMLQKLDIKNED-DVKSLSRVMVHVFSDSVTNWGRIVTLISFCA
M3XAP4_MCL1-03          HETAFQGMLRKLDIKNEN-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6GI15_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
C8YZ26_MCL1-01          HETAFQGMLRRLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
A0A2K5CFH3_MCL1-02      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
F7GTF7_MCL1-03          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6V5Y3_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K5LXU8_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K5I9Q7_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
A0A2I2YQH7_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
Q07820_MCL1-04          HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
A0A2K5W0W9_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
F7HUE9_MCL1-02          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6ECR0_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K5XSC7_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2R9BYH6_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
K7DE58_MCL1-03          HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
A0A2I3M3D6_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6KRW9_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6PPL1_MCL1-03      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
K7DE58_MCL1-04          ------CMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
A0A2I3GB35_MCL1-03      ------GMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
G2HFR3_MCL1-01          ------TIHMLLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
A0A1L1RNM6_MCL1-01      HELAFQGMLRKLEIKKED-DLQAVCEVAAHVFNDGVTNWGRVVTLISFGA
A0A1L1RNM6_MCL1-02      HELAFQGMLRKLEIKKED-DLQAVCEVAAHVFNDGVTNWGRVVTLISFGA
F6ZMX1_MCL1-01          HERAFQGMLRKLDIKNEE-DIKAVSRVATHVFSDGITNWGRIVTLISFGA
A0A286Y1M5_MCL1-01      HQTAFQGMLRKLDIKNED-DVKSLSRVVALVFSDGVTNWGRIVTLISFGA
P97287_MCL1-02          HETAFQGMLRKLDIKNEG-DVKSFSRVMVHVFKDGVTNWGRIVTLISFGA
P97287_MCL1-01          HETAFQGMLRKLDIKNEG-DVKSFSRVMVHVFKDGVTNWGRIVTLISFGA
G3T756_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMAHVFSDGITNWGRIVTLISFGA
G1L3M8_MCL1-02          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2U3V2H3_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
K9IWB2_MCL1-03          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
K9IWB2_MCL1-02          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
K9IWB2_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
B4DU51_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
A0A287DCH9_MCL1-02      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A287DCH9_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A452GAH0_MCL1-02      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K5I9Q7_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
G1PZ39_MCL1-01          HEMAFQGERGPR------------------ALCLVRDRWAPVGGNRDEPG
Q95KR3_MCL1-01          --SAFQGMLRKLDIKNED-DVKSLSRVMVHVLSDGVTNWGRIVTLISFGA
A0A2K5EPY9_MCL1-02      ---TC--MLRKLDIKNKD-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K5EPY9_MCL1-01      ---SSPGMLRKLDIKNKD-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
J9PBC4_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVIVHVFSDGVTNWGRIVTLISFGA
A0A2K5C7L5_MCL1-01      HETAFQV-----------------------LPCRRPRRW-----------
Q9Z1P3_MCL1-01          HETAFQGMLRKLDIKNED-DVKSFSRVMTHVFKDGVTNWGRIVTLISFGA
A5PJR2_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A452GAH0_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
G1L3M8_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
F7AVA6_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMAHVFSDGVTNWGRIVTLISFGA
G1T2Q0_MCL1-02          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
G1T2Q0_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
M3XAP4_MCL1-01          HETAFQGMLRKLDIKNEN-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
Q7YRZ9_MCL1-01          HETAFQGMLRKLDIKNEN-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
J9PBC4_MCL1-02          HETAFQGMLRKLDIKNED-DVKSLSRVIVHVFSDGVTNWGRIVTLISFGA
Q8HYS5_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVIVHVFSDGVTNWGRIVTLISFGA
M3XZZ5_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A452RHX5_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
H0XFB7_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6GI15_MCL1-02      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
F7GTF7_MCL1-02          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K5CFH3_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6V5Y3_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6KRW9_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6PPL1_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K5XSC7_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A0D9RZP5_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K5W0W9_MCL1-02      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
I7G687_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
F7HUE9_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6ECR0_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2I3M3D6_MCL1-02      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K5LXU8_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2I3GB35_MCL1-02      HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
H2N5Y9_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
Q07820_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
A0A2R9BYH6_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
K7DE58_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
A0A2I2YQH7_MCL1-01      HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
A0A2K5I9Q7_MCL1-02      HETAFQGWVCGV------------------LPCRGPRRW-----------
M3XAP4_MCL1-02          HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2K6GI15_MCL1-01      HETAFQGWVCGV------------------LPCRGPRRR-----------
F7GTF7_MCL1-01          HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2K5CFH3_MCL1-03      HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2K6V5Y3_MCL1-02      HETAFQGWVCGV------------------LPCRGSRRW-----------
A0A2K6KRW9_MCL1-02      HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2K6PPL1_MCL1-02      HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2K5LXU8_MCL1-02      HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2K5W0W9_MCL1-01      HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2K6ECR0_MCL1-02      HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2I3M3D6_MCL1-01      HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2K5XSC7_MCL1-02      HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2I3GB35_MCL1-01      HETAFQGWVCGV------------------LPCRGPRRW-----------
Q07820_MCL1-03          HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2R9BYH6_MCL1-02      HETAFQGWVCGV------------------LPCRGPRRW-----------
K7DE58_MCL1-02          HETAFQGWVCGV------------------LPCRGPRRW-----------
A0A2I2YQH7_MCL1-02      HETAFQGWVCGV------------------LPCRGPRRW-----------
G3WBC5_MCL1-01          HETAFQGMLRKLDIKNEE-DIKAVSRVVTHVFSDGVTNWGRIVTLISFGA
W5QI41_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
F1MQX4_MCL1-01          HETAFQGMLQKLDIKNED-DVKSLSRVMVHVFSDRVTNWGRIVTLISFGA
B4DLY8_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
B4DG83_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDGVTNWGRIVTLISFGA
B4E3L8_MCL1-01          HETAFQGMLRKLDIKNED-DVKSLSRVMIHVFSDSVTNWGRIVTLISFGA
G3PJT0_MCL1-01          HRYVFNGMVNKLSLDDRGDDASFVREVATSLFADGTTNWGRIASLVAFGA
A0A3Q3VP02_MCL1-01      HRYVYNGMTKRLSLADTQDNVSFVSTVSRDLFSDGATNWGRIASLVAFGV
A0A3B5K5B3_MCL1-01      HRYVYNGMTKQLTLDDRGDDVSFVSSVAKSIFADGVTNWGRIASLVAFGA
H2MLZ3_MCL1-01          HKITYNGMIVRLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGA
H2MLZ3_MCL1-02          HKITYNGMIVRLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGA
A0A3B3CEX1_MCL1-02      HRFAFNGMINRLSLEDNLDDMSFISRVAENMFADRTTNWGRIASLLAFGA
A0A3B3CEX1_MCL1-01      HRFAFNGMINRLSLEDNLDDMSFISRVAENMFADRTTNWGRIASLLAFGA
A0A3Q3B4V7_MCL1-01      HRFAYNGIIKKLSLDDKSEDMTFVTKTARSLFADGITNWGRISSLVAFGA
A0A3Q3B4V7_MCL1-02      HRFAYNGIIKKLSLDDKSEDMTFVTKTARSLFADGITNWGRISSLVAFGA
A0A3Q2EDX8_MCL1-01      HRYAYNGMMNKLCLDEVPDNMGFVSSVATSLFSDGTTNWGRIVSLVAFGA
A0A3Q2T2A9_MCL1-02      HRYAYTGMIRKLNLDQKSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGA
A0A3Q2T2A9_MCL1-01      HRYAYTGMIRKLNLDQKSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGA
A0A3B5PQ55_MCL1-02      HKYAYNGMVNRLALDNEPDDMEFVTEIAESLFSDGITNWGRIASLVTFGA
A0A3B5PQ55_MCL1-01      HKYAYNGMVNRLALDNEPDDMEFVTEIAESLFSDGITNWGRIASLVTFGA
A0A3P9Q4R7_MCL1-02      HRYAYNGMLSKLALDNQPDNMGFVTEVAESLFSDGTTNWGRIVSLVAFGA
A0A3P9Q4R7_MCL1-01      HRYAYNGMLSKLALDNQPDNMGFVTEVAESLFSDGTTNWGRIVSLVAFGA
A0A087X830_MCL1-01      HRYAYNGMLNRLALDNQPDNMGFVTEVAENLFSDGTTNWGRIVSLVAFGA
A0A3B3YCD0_MCL1-01      HRYAYNGMLNRLALDNQPDNMGFVTEVAENLFSDGTTNWGRIVSLVAFGA
A0A3P8VKS9_MCL1-02      HRYAYNGMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGA
A0A3P8VKS9_MCL1-01      HRYAYNGMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGA
A0A3P8VKS9_MCL1-05      HRYAYNGMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGA
A0A3P8VKS9_MCL1-04      HRYAYNGMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGA
A0A3P8VKS9_MCL1-03      HRYAYNGMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGA
I3JHR5_MCL1-01          HRYAYNGMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGA
A0A3Q4HLQ8_MCL1-01      HRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRVVSFVAFGA
A0A3P8NP63_MCL1-02      HRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGA
A0A3P8NP63_MCL1-03      HRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGA
A0A3Q2VNL8_MCL1-01      HRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGA
A0A3P8NP63_MCL1-01      HRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGA
A0A3P9BVM3_MCL1-01      HRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGA
A0A3B4G4Z6_MCL1-01      HRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGA
A0A2U9CJ81_MCL1-01      HRYAYNGMMNRLSLDNRRDDVTFVGAVARSLFGDGNTNWGRVSSLVAFGA
A0A3Q3IZW0_MCL1-01      HRYAYKGMINKLSLDERGDDMSFVGSVAQSIFADGTTNWGRITSLLAFGA
A0A3Q1GX28_MCL1-02      HRYAYNGMINKLSLDDKVDDVSFITAVAQSLFSDGTTNWGRIASLVAFGA
A0A3Q1GX28_MCL1-01      HRYAYNGMINKLSLDDKVDDVSFITAVAQSLFSDGTTNWGRIASLVAFGA
A0A3B4XKA5_MCL1-01      HRYAYNGMINKLSLDNRGDDVRFVGAVAKSLFADGTTNWGRIASLVAFGV
A0A3Q3GP42_MCL1-01      HRYAYNGMINKLSLEDRGDDASFVSAVAKSLFADGTTNWGRIASLVAFGA
A0A3Q3M6G2_MCL1-02      YRYTYNGMINKLSLDDRGDDVRFVSTVAKSLFADGTTNWGRIASLVAFGA
A0A3Q3M6G2_MCL1-01      YRYTYNGMINKLSLDDRGDDVRFVSTVAKSLFADGTTNWGRIASLVAFGA
A0A3B1IEV7_MCL1-01      HGIAYNGMVQKLNLEEQDDSMDIISSVAKALFSDGTTNWGRIVSLVAFGA
A0A3B4E3I4_MCL1-03      HSIAYNGMVQRLCLEQQDDSMEFISSVAKTLFNDGTTNWGRIASLVAFGA
A0A3B4E3I4_MCL1-02      HSVAYSGMVQRLCLEQQDDSMEFISSVAKTLFDDGITNWGRIASLVALGA
A0A3B4E3I4_MCL1-01      HSVAYSGMVQRLCLEQQDDSMEFISSVAKTLFNDGTTNWGRIASLVAFGA
A0A3B4AFB7_MCL1-01      HRYAYNGMINKLALDDRGDDVSFIGTVAKSIFEDGTTNWGRIASLIAFGA
Q8UWD6_MCL1-01          HELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGA
F8W4Q8_MCL1-01          HELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGA
Q568W5_MCL1-01          HELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGA
A0A3B1K5R1_MCL1-01      HGIAYKGMLNKLGMEDRGDDMYVIRAVAKELFSDGITNWGRVASLVAFGA
A0A3B4C6H5_MCL1-01      HELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFGA
A0A3B4C6H5_MCL1-02      HELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFGA
A0A3B4C6H5_MCL1-03      HELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFGA
Q568V1_MCL1-01          HQIAYKGMIQRLQLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGA
Q1L8X3_MCL1-01          HQIAYKGMIQRLQLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGA
Q9I9N3_MCL1-01          HQIAYKGMIQRLQLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGA
W5MMB7_MCL1-01          HQIAYHGMIAKLELENKGEDVSFVTGVAKSLFSDGKTNWGRIASLVSFGA
A0A3B3R4U0_MCL1-01      HLIAYNGMIKKLELDKRGDDTSFVTKVAEEIFSDKVTNWGRIASLIAFGG
A0A3B3SG34_MCL1-01      HKFAYNGMIGKLSLNQQSDDMTVIKTVAERIFSDGTTNWGRIASLVAFGA
A0A3Q2Y539_MCL1-01      HRILFNNMVNELSLDQRGLDRSFVSQVAQTEFANGNINWGRIASLLAFCA
Q4SW32_MCL1-01          HRYTYRGMINKLFMEDRVGDVSFVGAVAKSTFEDGNTNWGRVASLLAFAA
D2ITA0_MCL1-03          HQYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGA
D2ITA0_MCL1-04          HQYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGA
Q0KFR9_MCL1-01          HRYAYNGMVAKLDLDDRCDDMGVINSVAKTMFSDGITNWGRIASLVAFGA
A0A3P8Y1W8_MCL1-01      HTYAYKGMISKLCLDDQGDDMGFITSVAKSLFSDGTTNWGRIASLVGFGA
A0A3P8Y1W8_MCL1-02      HTYAYKGMISKLCLDDQGDDMGFITSVAKSLFSDGTTNWGRIASLVGFGA
A0A3Q2XZL8_MCL1-01      HKYKYNGIINKLSLDDRGDNVSFISEVAKSLFSDGTTNWGRVASLVAFGA
A0A3B4AFB7_MCL1-02      HRYAYNGMINKLALDDRGDDVSFIGTVAKSIFEDGTTNWGRIASLIAFGA
A0A3B3VM25_MCL1-01      HRYAYNGMLNRLALDNQPDNMGFVTEVAQNLFSDGTTNWGRIVSLVAFGA
A0A3Q0RA11_MCL1-03      HRYAYNGMVNKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGA
A0A3Q0RA11_MCL1-01      HRYAYNGMVNKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGA
A0A3B4T8L9_MCL1-02      HRYAYNGMINKLSLDNTGDDVRFVGAVAKSLFADGTTNWGRIASLVAFGA
A0A3B4T8L9_MCL1-01      HRYAYNGMINKLSLDNTGDDVRFVGAVAKSLFADGTTNWGRIASLVAFGA
A0A3Q1EQB9_MCL1-02      HRYSYNGMINKLSLDDIGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGA
A0A3B4ZKP6_MCL1-01      HRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGA
A0A3Q1BKL8_MCL1-02      HRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGA
A0A3Q1EQB9_MCL1-01      HRYSYNGMINKLSLDDIGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGA
A0A3Q1BKL8_MCL1-01      HRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGA
A0A3P8RQX7_MCL1-02      HRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGA
A0A3P8RQX7_MCL1-01      HRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGA
                                                             .            

A0A3Q0RA11_MCL1-02      VVCQRLKEKGRD-----NCVELVSQEISTYLLSDQRDWLVKNNAW---DG
I3KXG5_MCL1-01          VVSQHLKEKGRD-----NCVVLVSQEISAYLLSEQRDWIIKNNAW---DG
U3KKY6_MCL1-01          FVAKHLKSIKQE-----QSITSLAGIITDALVSSKRQWLESQGGW-----
G1MPY7_MCL1-01          FVAKHLKSINQE-----KCISSLAGIITDALVSSKREWLMSQGGW---EG
K7FPN7_MCL1-01          FVAKHLKSINQE-----NCINTLAGIITDVLVSDKRDWLVNQRGW---EG
F8W4Q8_MCL1-02          MLCKYQNDRGHS-----KYVRLVGEEISSYLLTEQRDWILRNKAW---DG
A0A2K5DMS4_MCL1-01      FVAKHLKTINQE-----SCIEPLAESI-------------RYSRW---DG
A0A3P8V8T6_MCL1-01      VLCQHLKEKGWE-----NTVDQVGQEIASYLLSYQKDWLLKNNSW---DG
B6V6J0_MCL1-01          FVAKHLKSLNLE-----DCIGVLAEHFTQFLMMSKKDWIIQEKGW---DG
F7ETY1_MCL1-01          FVAKHLKSIDLE-----DCIMALAEHFTLFLMTSKKDWIIQEKGW---EG
H3AR18_MCL1-02          VVAKKLKKMNLE-----DSIEQLAVSITDFLVQNKGDWILKNQGW---KG
H3AR18_MCL1-01          VVAKKLKKMNLE-----DSIEQLAVSITDFLVQNKGDWILKNQGW---KG
J7H260_MCL1-01          FVAKHLKSIHME-----NCVGILADSFTDYLMTQKKEWIVEHNGW---DG
H0XHA5_MCL1-01          FVAKHLKTINQE-----GYIKPLEENIADVLVRTKPDWLVKQRGW---DG
R4GAJ0_MCL1-01          FVAKHLKSINQE-----NAINTLIEIITDVLVTDKREWLLKHNAW---HN
R4GAJ0_MCL1-02          FVAKHLKSINQE-----NAINTLIEIITDVLVTDKREWLLKHNAW---EG
G1QAV8_MCL1-01          -LCSHLKSINQE-----SCIEPLAEDITDVLVGTERGWLVKQRGW---DG
A0A2K6F6N9_MCL1-01      FVSKHLKTINQE-----SCIEPLAESITDILVRTKRDWL-----------
M3XAP4_MCL1-03          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K6GI15_MCL1-03      FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
C8YZ26_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5CFH3_MCL1-02      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
F7GTF7_MCL1-03          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K6V5Y3_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5LXU8_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5I9Q7_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2I2YQH7_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
Q07820_MCL1-04          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5W0W9_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
F7HUE9_MCL1-02          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K6ECR0_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5XSC7_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2R9BYH6_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
K7DE58_MCL1-03          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2I3M3D6_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K6KRW9_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K6PPL1_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
K7DE58_MCL1-04          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2I3GB35_MCL1-03      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
G2HFR3_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A1L1RNM6_MCL1-01      FVAKHLKSINQE-----KCITSLAGIITDALVSSKREWLMSQGGW---EG
A0A1L1RNM6_MCL1-02      FVAKHLKSINQE-----KCITSLAGIITDALVSSKREWLMSQGGW---EG
F6ZMX1_MCL1-01          FVAKHLKSINQE-----SCIDPLAESITDVLVKTKRDWLIKQKGW---EG
A0A286Y1M5_MCL1-01      FVAKHLKSINQE-----SCIEPLAESITDALVHSKRDWLVKQRGW---DG
P97287_MCL1-02          FVAKHLKSVNQE-----SFIEPLAETITDVLVRTKRDWLVKQRGW---DG
P97287_MCL1-01          FVAKHLKSVNQE-----SFIEPLAETITDVLVRTKRDWLVKQRGW---DG
G3T756_MCL1-01          FVAKHLKSVNQE-----SRIEPLAESITDVLVRTKRDWLVKQRGW---DG
G1L3M8_MCL1-02          FVAKHLKSINQE-----GCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2U3V2H3_MCL1-01      FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
K9IWB2_MCL1-03          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
K9IWB2_MCL1-02          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
K9IWB2_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
B4DU51_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A287DCH9_MCL1-02      FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A287DCH9_MCL1-01      FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A452GAH0_MCL1-02      FVAKHLKSINQE-----SCIEPLAESITDVLVRSKRDWIVKQRGW---DG
A0A2K5I9Q7_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
G1PZ39_MCL1-01          LEGLSARFRNQHILAMSHCFRPPDSLGTALRSKAGKVWETSNTCHGFKDG
Q95KR3_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5EPY9_MCL1-02      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5EPY9_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
J9PBC4_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5C7L5_MCL1-01      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
Q9Z1P3_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A5PJR2_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRSKRDWIVKQRGW---DG
A0A452GAH0_MCL1-01      FVAKHLKSINQE-----SCIEPLAESITDVLVRSKRDWIVKQRGW---DG
G1L3M8_MCL1-01          FVAKHLKSINQE-----GCIEPLAESITDVLVRTKRDWLVKQRGW---DG
F7AVA6_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
G1T2Q0_MCL1-02          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
G1T2Q0_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
M3XAP4_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
Q7YRZ9_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
J9PBC4_MCL1-02          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
Q8HYS5_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
M3XZZ5_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A452RHX5_MCL1-01      FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
H0XFB7_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K6GI15_MCL1-02      FVAKHLKSINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
F7GTF7_MCL1-02          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5CFH3_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K6V5Y3_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K6KRW9_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K6PPL1_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5XSC7_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A0D9RZP5_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5W0W9_MCL1-02      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
I7G687_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
F7HUE9_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K6ECR0_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2I3M3D6_MCL1-02      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5LXU8_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2I3GB35_MCL1-02      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
H2N5Y9_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
Q07820_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2R9BYH6_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
K7DE58_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2I2YQH7_MCL1-01      FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
A0A2K5I9Q7_MCL1-02      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
M3XAP4_MCL1-02          ----------HQ-----KCAAGFCRCCWS------RSWF-----------
A0A2K6GI15_MCL1-01      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
F7GTF7_MCL1-01          ----------HQ-----KCAAGFCGCCWS------RSWV-----------
A0A2K5CFH3_MCL1-03      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
A0A2K6V5Y3_MCL1-02      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
A0A2K6KRW9_MCL1-02      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
A0A2K6PPL1_MCL1-02      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
A0A2K5LXU8_MCL1-02      ----------HQ-----KCAAGCCRCCWS------RSWF-----------
A0A2K5W0W9_MCL1-01      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
A0A2K6ECR0_MCL1-02      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
A0A2I3M3D6_MCL1-01      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
A0A2K5XSC7_MCL1-02      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
A0A2I3GB35_MCL1-01      ----------HQ-----KCAAGFCRCCWS------RSWF-----------
Q07820_MCL1-03          ----------HQ-----ECAAGFCRCCWS------RSWF-----------
A0A2R9BYH6_MCL1-02      ----------HQ-----ECAAGFCRCCWS------RSWF-----------
K7DE58_MCL1-02          ----------HQ-----ECAAGFCRCCWS------RSWF-----------
A0A2I2YQH7_MCL1-02      ----------HQ-----ECAAGFCRCCWS------RSWF-----------
G3WBC5_MCL1-01          FVAKHLKSINQE-----SCIDPLAESITDVLVKSKRDWLMKQKGW---EG
W5QI41_MCL1-01          FVAKHLKSINQE-----SCIEPLAESITDVLVRSKRDWIVKQRGW---DG
F1MQX4_MCL1-01          FVAKHFKSINQE-----SCIEPLAESITDVLVRSKRDWIVKERGW---DG
B4DLY8_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
B4DG83_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
B4E3L8_MCL1-01          FVAKHLKTINQE-----SCIEPLAESITDVLVRTKRDWLVKQRGW---DG
G3PJT0_MCL1-01          VVCQHLAERGRG-----NCVELVGQEISAYLLSDQRDWLIKNNAW---VG
A0A3Q3VP02_MCL1-01      VVSQCLKENGKS-----DRVELVAHEISTYLLTDQRDWMCV--GG---DG
A0A3B5K5B3_MCL1-01      VVAQHMKDNGRR-----DCVEPVAQEISTYLLTDRRDWLIKNNGW---EG
H2MLZ3_MCL1-01          AVCQSLKEKGRG-----HCVDLVSQEICTYLLSEQRNWLVNNNSW---DG
H2MLZ3_MCL1-02          AVCQSLKEKGRG-----HCVDLVSQEICTYLLSEQRNWLVNNNSW---DG
A0A3B3CEX1_MCL1-02      AVCLQLKEKGRG-----HSVDLVSQEICTYLLREQRDWLINNNSW---DG
A0A3B3CEX1_MCL1-01      AVCLQLKEKGRG-----HSVDLVSQEICTYLLREQRDWLINNNSW---DG
A0A3Q3B4V7_MCL1-01      VVAVHLKEKGRE-----ECVELVGQEISTYLLSEQKDWLLKNNSW---SG
A0A3Q3B4V7_MCL1-02      VVAVHLKEKGRE-----ECVELVGQEISTYLLSEQKDWLLKNNSW---SG
A0A3Q2EDX8_MCL1-01      VVCQHLKEKGRE-----NCVELVSQEISTYLLQNQRDWLVKNNSW---NG
A0A3Q2T2A9_MCL1-02      VLCQHLKESGRS-----HCVDLVSREISTYLLTNQRDWLAKNNSW---DG
A0A3Q2T2A9_MCL1-01      VLCQHLKESGRS-----HCVDLVSREISTYLLTNQRDWLAKNNSW---DG
A0A3B5PQ55_MCL1-02      AVCQRLKERGRE-----HCVELVSRKISTYLLANQRDWLAKNNSW---EG
A0A3B5PQ55_MCL1-01      AVCQRLKERGRE-----HCVELVSRKISTYLLANQRDWLAKNNSW---EG
A0A3P9Q4R7_MCL1-02      VVCQHLKERGRE-----HCVDLVSQEISTYLLAKQRDWLAKNNSW---EG
A0A3P9Q4R7_MCL1-01      VVCQHLKERGRE-----HCVDLVSQEISTYLLAKQRDWLAKNNSW---EG
A0A087X830_MCL1-01      AVCQHLKERGRE-----HCVELVSKEISTYLLENQRDWLAKNNSW---EG
A0A3B3YCD0_MCL1-01      AVCQHLKERGRE-----HCVELVSKEISTYLLENQRDWLAKNNSW---EG
A0A3P8VKS9_MCL1-02      VVCQHLKECGQE-----NSTELVGREISSYLLSYQRDWLLKNNSW---DG
A0A3P8VKS9_MCL1-01      VVCQHLKECGQE-----NSTELVGREISSYLLSYQRDWLLKNNSW---DG
A0A3P8VKS9_MCL1-05      VVCQHLKECGQE-----NSTELVGREISSYLLSYQRDWLLKNNSW---DG
A0A3P8VKS9_MCL1-04      VVCQHLKECGQE-----NSTELVGREISSYLLSYQRDWLLKNNSW---DG
A0A3P8VKS9_MCL1-03      VVCQHLKECGQE-----NSTELVGREISSYLLSYQRDWLLKNNSW---DG
I3JHR5_MCL1-01          VVSQHLKEKGRD-----NCVALVSQEVSAYLLSEQRDWIVKNNAW---DG
A0A3Q4HLQ8_MCL1-01      VVSQHLKEKGRD-----NCVALVSQEISAYLLSEQRDWIVKNNAW---DG
A0A3P8NP63_MCL1-02      VVSQHLKEKGRD-----NYVALVSQEISAYLLSEQRDWIVKNNAW---DG
A0A3P8NP63_MCL1-03      VVSQHLKEKGRD-----NYVALVSQEISAYLLSEQRDWIVKNNAW---DG
A0A3Q2VNL8_MCL1-01      VVSQHLKEKGRD-----NYVALVSQEISAYLLSEQRDWIVKNNAW---DG
A0A3P8NP63_MCL1-01      VVSQHLKEKGRD-----NYVALVSQEISAYLLSEQRDWIVKNNAW---DG
A0A3P9BVM3_MCL1-01      VVSQHLKEKGRD-----NYVALVSQEISAYLLSEQRDWIVKNNAW---DG
A0A3B4G4Z6_MCL1-01      VVSQHLKEKGRD-----NYVALVSQEISAYLLSEQRDWIVKNNAW---DG
A0A2U9CJ81_MCL1-01      VVSQHLKETGRG-----NCVELVGQEISTYLLTDQRDWLVKNNSW---EG
A0A3Q3IZW0_MCL1-01      VVCQYLKEKGRE-----NCVELVGQEISTYLLSHQRDWLVKNNAW---DG
A0A3Q1GX28_MCL1-02      AVCQHLKEKHRE-----NCVDLVAQEISSYLLSAQRDWLVRNNSW---DG
A0A3Q1GX28_MCL1-01      AVCQHLKEKHRE-----NCVDLVAQEISSYLLSAQRDWLVRNNSW---DG
A0A3B4XKA5_MCL1-01      VVCQHMKDTGRE-----NCVESVGQEISKYLLSDQRDWLVKNNSW---DG
A0A3Q3GP42_MCL1-01      AVSQYLKENGRG-----HCVELVGQEISTYLLSDHRDWLVKNNAW---DG
A0A3Q3M6G2_MCL1-02      VVCQYLKEKGRG-----DCVELVGQEISTYLLSDQRDWLVKNNSW---DG
A0A3Q3M6G2_MCL1-01      VVCQYLKEKGRG-----DCVELVGQEISTYLLSDQRDWLVKNNSW---DG
A0A3B1IEV7_MCL1-01      VVCDHLKKKSRD-----HCVENVAQHISTYLNTHQHQWLINNNAW---DG
A0A3B4E3I4_MCL1-03      VVCEQMKEAGRE-----QCVENVIQHISTYLSTDQRQWLINNKAW---GG
A0A3B4E3I4_MCL1-02      VVCEWLKEVGRE-----QCVENVIQHISMYLSTDQRQWLINNKAW---GG
A0A3B4E3I4_MCL1-01      VVCEQMKEAGRE-----QCVENVIQHISTYLSTDQRQWLINNKAW---GG
A0A3B4AFB7_MCL1-01      VVCQYLKTKGRE-----SCVERVGQEISSYLLLDQRDWLVRNNAW---DG
Q8UWD6_MCL1-01          MLCKYQNDRGHS-----KYVRLVGEEISSYLLTEQRDWILRNKAW---DG
F8W4Q8_MCL1-01          MLCKYQNDRGHS-----KYVRLVGEEISSYLLTEQRDWILRNKAW---DG
Q568W5_MCL1-01          MLCKYQNDRGHS-----KYVRLVGEEISSYLLTEQRDWILRNKAW---DG
A0A3B1K5R1_MCL1-01      VVSKHQHDMGRG-----HCVSLVGEELSSYLLSDERDWLLKNKAW---DG
A0A3B4C6H5_MCL1-01      VVCQHQNQMGRG-----HCVSLVGQEISSYLLSDQKDWLLKNKAW---DG
A0A3B4C6H5_MCL1-02      VVCQHQNQMGRG-----HCVSLVGQEISSYLLSDQKDWLLKNKAW---DG
A0A3B4C6H5_MCL1-03      VVCQHQNQMGRG-----HCVSLVGQEISSYLLSDQKDWLLKNKAW---DG
Q568V1_MCL1-01          VVCSRLKELQQD-----QCVERVAEQISSYLTSEQQDWILKNKSC---HG
Q1L8X3_MCL1-01          VVCSRLKELQQD-----QCVERVAEQISSYLTSEQQDWILKNKSW---HG
Q9I9N3_MCL1-01          VVCSRLKELQQD-----QCVERVAEQISSYLTSEQQDWILKNKSW---HG
W5MMB7_MCL1-01          VVAKQMKDSGRE-----SCVEAVGQAISNYLLQDQREWLLNNRGW---DG
A0A3B3R4U0_MCL1-01      VVCKYLKDHGQT-----NCVDDVASRISCYLLEHQRDWLNRNNGW---EG
A0A3B3SG34_MCL1-01      EVCKYLKETGRE-----HCVEAVGKQISSYLLSEQRQWLLKNKAW---DG
A0A3Q2Y539_MCL1-01      VLSQALKENQQE-----RCVELVAQEVSTYLLSHQRTWLVQHNGW---DG
Q4SW32_MCL1-01          VVAQYLNDHGQR-----DCVEQVAQEISTYLLTDQRDWLIKNNAW---DG
D2ITA0_MCL1-03          ALCQYLEARGKE-----GCVSLVAEEISSYLLSDQREWLVKNNSW---EG
D2ITA0_MCL1-04          ALCQYLEARGKE-----GCVSLVAEEISSYLLSDQREWLVKNNSW---EG
Q0KFR9_MCL1-01          VVSQHLKERGRG-----HCVELVGQEIAKYLLSDQSDWLIKNNAW---NG
A0A3P8Y1W8_MCL1-01      VVSQHLKEMGKG-----NCVELVGQEISTYLLTDQRAWLVKNNAW---DG
A0A3P8Y1W8_MCL1-02      VVSQHLKEMGKG-----NCVELVGQEISTYLLTDQRAWLVKNNAW---DG
A0A3Q2XZL8_MCL1-01      IVSQHLKEKGRA-----HCVEPVADEISSYLLSHQRNWLVKNNSW---DG
A0A3B4AFB7_MCL1-02      VVCQYLKTKGRE-----SCVERVGQEISSYLLLDQRDWLVRNNAW---DG
A0A3B3VM25_MCL1-01      AVCQHLKERGRE-----HCVELVIQEISTYLLENQRDWLAKNNSW---EG
A0A3Q0RA11_MCL1-03      VVCQRLKEKGRD-----NCVELVSQEISTYLLSDQRDWLVKNNAW---DG
A0A3Q0RA11_MCL1-01      VVCQRLKEKGRD-----NCVELVSQEISTYLLSDQRDWLVKNNAW---DG
A0A3B4T8L9_MCL1-02      VVCQRMKETGRE-----NCVESVGQEISKYLLSDQRDWLVKNNSW---DG
A0A3B4T8L9_MCL1-01      VVCQRMKETGRE-----NCVESVGQEISKYLLSDQRDWLVKNNSW---DG
A0A3Q1EQB9_MCL1-02      VVCQYLKERGRE-----NCVDLVSQEISTYLLSEQRDWLVKNNSW---DG
A0A3B4ZKP6_MCL1-01      VVCQYLKERGRE-----NCVDLVSEEISTYLLCDQRDWLVKNNSW---DG
A0A3Q1BKL8_MCL1-02      VVCQYLKERGRE-----NCVDLVSQEISTYLLSEQRDWLVKNNSW---DG
A0A3Q1EQB9_MCL1-01      VVCQYLKERGRE-----NCVDLVSQEISTYLLSEQRDWLVKNNSW---DG
A0A3Q1BKL8_MCL1-01      VVCQYLKERGRE-----NCVDLVSQEISTYLLSEQRDWLVKNNSW---DG
A0A3P8RQX7_MCL1-02      VVCQYLKERGRE-----NCVDLVSQEISTYLLSEQRDWLVKNNSW---DG
A0A3P8RQX7_MCL1-01      VVCQYLKERGRE-----NCVDLVSQEISTYLLSEQRDWLVKNNSW---DG
                                                                          

A0A3Q0RA11_MCL1-02      FV------------------------------------------------
I3KXG5_MCL1-01          FV------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          FV------------------------------------------------
K7FPN7_MCL1-01          FV------------------------------------------------
F8W4Q8_MCL1-02          FV------------------------------------------------
A0A2K5DMS4_MCL1-01      FV------------------------------------------------
A0A3P8V8T6_MCL1-01      FV------------------------------------------------
B6V6J0_MCL1-01          FV------------------------------------------------
F7ETY1_MCL1-01          FV------------------------------------------------
H3AR18_MCL1-02          FV------------------------------------------------
H3AR18_MCL1-01          FV------------------------------------------------
J7H260_MCL1-01          CV------------------------------------------------
H0XHA5_MCL1-01          FV------------------------------------------------
R4GAJ0_MCL1-01          CV------------------------------------------------
R4GAJ0_MCL1-02          FV------------------------------------------------
G1QAV8_MCL1-01          FV------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          FV------------------------------------------------
A0A2K6GI15_MCL1-03      FV------------------------------------------------
C8YZ26_MCL1-01          FV------------------------------------------------
A0A2K5CFH3_MCL1-02      FV------------------------------------------------
F7GTF7_MCL1-03          FV------------------------------------------------
A0A2K6V5Y3_MCL1-03      FV------------------------------------------------
A0A2K5LXU8_MCL1-03      FV------------------------------------------------
A0A2K5I9Q7_MCL1-03      FV------------------------------------------------
A0A2I2YQH7_MCL1-03      FV------------------------------------------------
Q07820_MCL1-04          FV------------------------------------------------
A0A2K5W0W9_MCL1-03      FV------------------------------------------------
F7HUE9_MCL1-02          FV------------------------------------------------
A0A2K6ECR0_MCL1-03      FV------------------------------------------------
A0A2K5XSC7_MCL1-03      FV------------------------------------------------
A0A2R9BYH6_MCL1-03      FV------------------------------------------------
K7DE58_MCL1-03          FV------------------------------------------------
A0A2I3M3D6_MCL1-03      FV------------------------------------------------
A0A2K6KRW9_MCL1-03      FV------------------------------------------------
A0A2K6PPL1_MCL1-03      FV------------------------------------------------
K7DE58_MCL1-04          FV------------------------------------------------
A0A2I3GB35_MCL1-03      FV------------------------------------------------
G2HFR3_MCL1-01          FV------------------------------------------------
A0A1L1RNM6_MCL1-01      FV------------------------------------------------
A0A1L1RNM6_MCL1-02      FV------------------------------------------------
F6ZMX1_MCL1-01          FV------------------------------------------------
A0A286Y1M5_MCL1-01      FV------------------------------------------------
P97287_MCL1-02          FV------------------------------------------------
P97287_MCL1-01          FV------------------------------------------------
G3T756_MCL1-01          FV------------------------------------------------
G1L3M8_MCL1-02          FV------------------------------------------------
A0A2U3V2H3_MCL1-01      FV------------------------------------------------
K9IWB2_MCL1-03          FV------------------------------------------------
K9IWB2_MCL1-02          FV------------------------------------------------
K9IWB2_MCL1-01          FV------------------------------------------------
B4DU51_MCL1-01          FV------------------------------------------------
A0A287DCH9_MCL1-02      FV------------------------------------------------
A0A287DCH9_MCL1-01      FV------------------------------------------------
A0A452GAH0_MCL1-02      FV------------------------------------------------
A0A2K5I9Q7_MCL1-01      FV------------------------------------------------
G1PZ39_MCL1-01          FV------------------------------------------------
Q95KR3_MCL1-01          FV------------------------------------------------
A0A2K5EPY9_MCL1-02      FV------------------------------------------------
A0A2K5EPY9_MCL1-01      FV------------------------------------------------
J9PBC4_MCL1-01          GVWGEWSTPSDLKGESRKECCPSWAAEAGRWGADLSLQTVAQWLSPLLSA
A0A2K5C7L5_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          FV------------------------------------------------
A5PJR2_MCL1-01          FV------------------------------------------------
A0A452GAH0_MCL1-01      FV------------------------------------------------
G1L3M8_MCL1-01          FV------------------------------------------------
F7AVA6_MCL1-01          FV------------------------------------------------
G1T2Q0_MCL1-02          FV------------------------------------------------
G1T2Q0_MCL1-01          FV------------------------------------------------
M3XAP4_MCL1-01          FV------------------------------------------------
Q7YRZ9_MCL1-01          FV------------------------------------------------
J9PBC4_MCL1-02          FV------------------------------------------------
Q8HYS5_MCL1-01          FV------------------------------------------------
M3XZZ5_MCL1-01          FV------------------------------------------------
A0A452RHX5_MCL1-01      FV------------------------------------------------
H0XFB7_MCL1-01          FV------------------------------------------------
A0A2K6GI15_MCL1-02      FV------------------------------------------------
F7GTF7_MCL1-02          FV------------------------------------------------
A0A2K5CFH3_MCL1-01      FV------------------------------------------------
A0A2K6V5Y3_MCL1-01      FV------------------------------------------------
A0A2K6KRW9_MCL1-01      FV------------------------------------------------
A0A2K6PPL1_MCL1-01      FV------------------------------------------------
A0A2K5XSC7_MCL1-01      FV------------------------------------------------
A0A0D9RZP5_MCL1-01      FV------------------------------------------------
A0A2K5W0W9_MCL1-02      FV------------------------------------------------
I7G687_MCL1-01          FV------------------------------------------------
F7HUE9_MCL1-01          FV------------------------------------------------
A0A2K6ECR0_MCL1-01      FV------------------------------------------------
A0A2I3M3D6_MCL1-02      FV------------------------------------------------
A0A2K5LXU8_MCL1-01      FV------------------------------------------------
A0A2I3GB35_MCL1-02      FV------------------------------------------------
H2N5Y9_MCL1-01          FV------------------------------------------------
Q07820_MCL1-01          FV------------------------------------------------
A0A2R9BYH6_MCL1-01      FV------------------------------------------------
K7DE58_MCL1-01          FV------------------------------------------------
A0A2I2YQH7_MCL1-01      FV------------------------------------------------
A0A2K5I9Q7_MCL1-02      --------------------------------------------------
M3XAP4_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K6V5Y3_MCL1-02      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPL1_MCL1-02      --------------------------------------------------
A0A2K5LXU8_MCL1-02      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3M3D6_MCL1-01      --------------------------------------------------
A0A2K5XSC7_MCL1-02      --------------------------------------------------
A0A2I3GB35_MCL1-01      --------------------------------------------------
Q07820_MCL1-03          --------------------------------------------------
A0A2R9BYH6_MCL1-02      --------------------------------------------------
K7DE58_MCL1-02          --------------------------------------------------
A0A2I2YQH7_MCL1-02      --------------------------------------------------
G3WBC5_MCL1-01          FV------------------------------------------------
W5QI41_MCL1-01          FV------------------------------------------------
F1MQX4_MCL1-01          FV------------------------------------------------
B4DLY8_MCL1-01          FV------------------------------------------------
B4DG83_MCL1-01          FV------------------------------------------------
B4E3L8_MCL1-01          FV------------------------------------------------
G3PJT0_MCL1-01          FV------------------------------------------------
A0A3Q3VP02_MCL1-01      FV------------------------------------------------
A0A3B5K5B3_MCL1-01      FV------------------------------------------------
H2MLZ3_MCL1-01          FV------------------------------------------------
H2MLZ3_MCL1-02          FV------------------------------------------------
A0A3B3CEX1_MCL1-02      FV------------------------------------------------
A0A3B3CEX1_MCL1-01      FV------------------------------------------------
A0A3Q3B4V7_MCL1-01      FV------------------------------------------------
A0A3Q3B4V7_MCL1-02      FV------------------------------------------------
A0A3Q2EDX8_MCL1-01      FV------------------------------------------------
A0A3Q2T2A9_MCL1-02      FV------------------------------------------------
A0A3Q2T2A9_MCL1-01      FV------------------------------------------------
A0A3B5PQ55_MCL1-02      FV------------------------------------------------
A0A3B5PQ55_MCL1-01      FV------------------------------------------------
A0A3P9Q4R7_MCL1-02      FV------------------------------------------------
A0A3P9Q4R7_MCL1-01      FV------------------------------------------------
A0A087X830_MCL1-01      FV------------------------------------------------
A0A3B3YCD0_MCL1-01      FV------------------------------------------------
A0A3P8VKS9_MCL1-02      FV------------------------------------------------
A0A3P8VKS9_MCL1-01      FV------------------------------------------------
A0A3P8VKS9_MCL1-05      FV------------------------------------------------
A0A3P8VKS9_MCL1-04      FV------------------------------------------------
A0A3P8VKS9_MCL1-03      FV------------------------------------------------
I3JHR5_MCL1-01          FV------------------------------------------------
A0A3Q4HLQ8_MCL1-01      FV------------------------------------------------
A0A3P8NP63_MCL1-02      FV------------------------------------------------
A0A3P8NP63_MCL1-03      FV------------------------------------------------
A0A3Q2VNL8_MCL1-01      FV------------------------------------------------
A0A3P8NP63_MCL1-01      FV------------------------------------------------
A0A3P9BVM3_MCL1-01      FV------------------------------------------------
A0A3B4G4Z6_MCL1-01      FV------------------------------------------------
A0A2U9CJ81_MCL1-01      FV------------------------------------------------
A0A3Q3IZW0_MCL1-01      FE------------------------------------------------
A0A3Q1GX28_MCL1-02      FV------------------------------------------------
A0A3Q1GX28_MCL1-01      FV------------------------------------------------
A0A3B4XKA5_MCL1-01      FV------------------------------------------------
A0A3Q3GP42_MCL1-01      FV------------------------------------------------
A0A3Q3M6G2_MCL1-02      FV------------------------------------------------
A0A3Q3M6G2_MCL1-01      FV------------------------------------------------
A0A3B1IEV7_MCL1-01      FV------------------------------------------------
A0A3B4E3I4_MCL1-03      FV------------------------------------------------
A0A3B4E3I4_MCL1-02      FV------------------------------------------------
A0A3B4E3I4_MCL1-01      FV------------------------------------------------
A0A3B4AFB7_MCL1-01      FV------------------------------------------------
Q8UWD6_MCL1-01          FV------------------------------------------------
F8W4Q8_MCL1-01          FV------------------------------------------------
Q568W5_MCL1-01          FV------------------------------------------------
A0A3B1K5R1_MCL1-01      FV------------------------------------------------
A0A3B4C6H5_MCL1-01      FV------------------------------------------------
A0A3B4C6H5_MCL1-02      FV------------------------------------------------
A0A3B4C6H5_MCL1-03      FV------------------------------------------------
Q568V1_MCL1-01          FV------------------------------------------------
Q1L8X3_MCL1-01          FV------------------------------------------------
Q9I9N3_MCL1-01          FV------------------------------------------------
W5MMB7_MCL1-01          FV------------------------------------------------
A0A3B3R4U0_MCL1-01      FT------------------------------------------------
A0A3B3SG34_MCL1-01      FV------------------------------------------------
A0A3Q2Y539_MCL1-01      FA------------------------------------------------
Q4SW32_MCL1-01          FV------------------------------------------------
D2ITA0_MCL1-03          FV------------------------------------------------
D2ITA0_MCL1-04          FV------------------------------------------------
Q0KFR9_MCL1-01          FV------------------------------------------------
A0A3P8Y1W8_MCL1-01      FV------------------------------------------------
A0A3P8Y1W8_MCL1-02      FV------------------------------------------------
A0A3Q2XZL8_MCL1-01      FV------------------------------------------------
A0A3B4AFB7_MCL1-02      FV------------------------------------------------
A0A3B3VM25_MCL1-01      FV------------------------------------------------
A0A3Q0RA11_MCL1-03      FV------------------------------------------------
A0A3Q0RA11_MCL1-01      FV------------------------------------------------
A0A3B4T8L9_MCL1-02      FV------------------------------------------------
A0A3B4T8L9_MCL1-01      FV------------------------------------------------
A0A3Q1EQB9_MCL1-02      FV------------------------------------------------
A0A3B4ZKP6_MCL1-01      FV------------------------------------------------
A0A3Q1BKL8_MCL1-02      FV------------------------------------------------
A0A3Q1EQB9_MCL1-01      FV------------------------------------------------
A0A3Q1BKL8_MCL1-01      FV------------------------------------------------
A0A3P8RQX7_MCL1-02      FV------------------------------------------------
A0A3P8RQX7_MCL1-01      FV------------------------------------------------
                                                                          

A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
F7ETY1_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-02          --------------------------------------------------
G1QAV8_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-03          --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSC7_MCL1-03      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-02      --------------------------------------------------
F6ZMX1_MCL1-01          --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-02          --------------------------------------------------
P97287_MCL1-01          --------------------------------------------------
G3T756_MCL1-01          --------------------------------------------------
G1L3M8_MCL1-02          --------------------------------------------------
A0A2U3V2H3_MCL1-01      --------------------------------------------------
K9IWB2_MCL1-03          --------------------------------------------------
K9IWB2_MCL1-02          --------------------------------------------------
K9IWB2_MCL1-01          --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      --------------------------------------------------
A0A452GAH0_MCL1-02      --------------------------------------------------
A0A2K5I9Q7_MCL1-01      --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          CRNSSAPPSSPLGIVYRTAWATQHTLFLKMILIWFALLPPRGPRWPREAW
A0A2K5C7L5_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A452GAH0_MCL1-01      --------------------------------------------------
G1L3M8_MCL1-01          --------------------------------------------------
F7AVA6_MCL1-01          --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
M3XAP4_MCL1-01          --------------------------------------------------
Q7YRZ9_MCL1-01          --------------------------------------------------
J9PBC4_MCL1-02          --------------------------------------------------
Q8HYS5_MCL1-01          --------------------------------------------------
M3XZZ5_MCL1-01          --------------------------------------------------
A0A452RHX5_MCL1-01      --------------------------------------------------
H0XFB7_MCL1-01          --------------------------------------------------
A0A2K6GI15_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5CFH3_MCL1-01      --------------------------------------------------
A0A2K6V5Y3_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K6PPL1_MCL1-01      --------------------------------------------------
A0A2K5XSC7_MCL1-01      --------------------------------------------------
A0A0D9RZP5_MCL1-01      --------------------------------------------------
A0A2K5W0W9_MCL1-02      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
F7HUE9_MCL1-01          --------------------------------------------------
A0A2K6ECR0_MCL1-01      --------------------------------------------------
A0A2I3M3D6_MCL1-02      --------------------------------------------------
A0A2K5LXU8_MCL1-01      --------------------------------------------------
A0A2I3GB35_MCL1-02      --------------------------------------------------
H2N5Y9_MCL1-01          --------------------------------------------------
Q07820_MCL1-01          --------------------------------------------------
A0A2R9BYH6_MCL1-01      --------------------------------------------------
K7DE58_MCL1-01          --------------------------------------------------
A0A2I2YQH7_MCL1-01      --------------------------------------------------
A0A2K5I9Q7_MCL1-02      --------------------------------------------------
M3XAP4_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K6V5Y3_MCL1-02      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPL1_MCL1-02      --------------------------------------------------
A0A2K5LXU8_MCL1-02      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3M3D6_MCL1-01      --------------------------------------------------
A0A2K5XSC7_MCL1-02      --------------------------------------------------
A0A2I3GB35_MCL1-01      --------------------------------------------------
Q07820_MCL1-03          --------------------------------------------------
A0A2R9BYH6_MCL1-02      --------------------------------------------------
K7DE58_MCL1-02          --------------------------------------------------
A0A2I2YQH7_MCL1-02      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
H2MLZ3_MCL1-01          --------------------------------------------------
H2MLZ3_MCL1-02          --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2T2A9_MCL1-02      --------------------------------------------------
A0A3Q2T2A9_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4R7_MCL1-02      --------------------------------------------------
A0A3P9Q4R7_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-02      --------------------------------------------------
A0A3P8VKS9_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-05      --------------------------------------------------
A0A3P8VKS9_MCL1-04      --------------------------------------------------
A0A3P8VKS9_MCL1-03      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3P8NP63_MCL1-03      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4E3I4_MCL1-03      --------------------------------------------------
A0A3B4E3I4_MCL1-02      --------------------------------------------------
A0A3B4E3I4_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-02      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0RA11_MCL1-03      --------------------------------------------------
A0A3Q0RA11_MCL1-01      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
                                                                          

A0A3Q0RA11_MCL1-02      -----------------EFFRVADPESTVRNTLMAFAGFAGIGATLALLI
I3KXG5_MCL1-01          -----------------AFVRVADPESIVRNTLMAFAGFACIGATLALLI
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          -----------------DFFRVEDLESSIRNVLMAFAGVAGLGASLAYMI
K7FPN7_MCL1-01          -----------------EFFRVEDLEGSIRNVLVAFAGFAGLGASLAYMM
F8W4Q8_MCL1-02          -----------------EFFHVPDTEAAVRNTLLTIGGVATLSAALAYWI
A0A2K5DMS4_MCL1-01      -----------------EFFRVEDLEGGIRNGLLAFAGVAGVGTDLAYLI
A0A3P8V8T6_MCL1-01      -----------------EFFQGQEPEKAIRCTLLGFVGFAGLWATLALLM
B6V6J0_MCL1-01          -----------------DFFHIEDYESGLKTVLMAFSSVAVLGAGLAYMI
F7ETY1_MCL1-01          -----------------DFFHIEDYESGLRTVLMAFSSVAVLGAGLAFMI
H3AR18_MCL1-02          -----------------DFFHVEDAEGTIKNVLMTFAGVAGLGASLVYLM
H3AR18_MCL1-01          -----------------DFFHVEDAEGTIKNVLMTFAGVAGLGASLVYLM
J7H260_MCL1-01          -----------------EFFHVEDYESGLKTVLMAFAGVAGLGASLAYMI
H0XHA5_MCL1-01          -----------------EFFYLEDLESSVRNVLLAFAGVAGVGAGLTYLI
R4GAJ0_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-02          -----------------QFFHVEDIEGGIRNVLVAFASVAGIGAGLAYMI
G1QAV8_MCL1-01          -----------------EFFQVEDLEGGVRNVLLAFAG-AGVGAGLPYLI
A0A2K6F6N9_MCL1-01      ------------------FFHVEDLEGSIRNVLLAFAGVAGVGAGLTYLI
M3XAP4_MCL1-03          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K6GI15_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
C8YZ26_MCL1-01          -----------------EFFQVEDLEGGIRNVLLAFAGVAGVGAGLAYLK
A0A2K5CFH3_MCL1-02      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLALSL
F7GTF7_MCL1-03          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K6V5Y3_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K5LXU8_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAVAGVAGVGAGLAYLI
A0A2K5I9Q7_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2I2YQH7_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
Q07820_MCL1-04          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K5W0W9_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
F7HUE9_MCL1-02          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K6ECR0_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K5XSC7_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2R9BYH6_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
K7DE58_MCL1-03          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2I3M3D6_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K6KRW9_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K6PPL1_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
K7DE58_MCL1-04          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2I3GB35_MCL1-03      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
G2HFR3_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A1L1RNM6_MCL1-01      -----------------DFFRVEDLESSIRNVLMAFAGVAGLGASLAYMI
A0A1L1RNM6_MCL1-02      -----------------DFFRVEDLESSIRNVLMAFAGVAGLGASLAYMI
F6ZMX1_MCL1-01          -----------------EFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A286Y1M5_MCL1-01      -----------------EFFHIEDLEGGIRNVLLAFAGVAGVGAGLAYLI
P97287_MCL1-02          -----------------EFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLI
P97287_MCL1-01          -----------------EFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLI
G3T756_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
G1L3M8_MCL1-02          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2U3V2H3_MCL1-01      -----------------DFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
K9IWB2_MCL1-03          -----------------EFFHVEDLEGGISNKIAF---------------
K9IWB2_MCL1-02          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
K9IWB2_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
B4DU51_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A287DCH9_MCL1-02      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A287DCH9_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A452GAH0_MCL1-02      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K5I9Q7_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
G1PZ39_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
Q95KR3_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K5EPY9_MCL1-02      -----------------EFFHVEDLEGGIRNVLLAFACVAGVGAGLAYLI
A0A2K5EPY9_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFACVAGVGAGLAYLI
J9PBC4_MCL1-01          VTTCGTPTPRSGPEAPWEFLSLPATQLFLPFLTKLLLEHSGISAGLKHFV
A0A2K5C7L5_MCL1-01      ----------------------------------------GISNKIAL--
Q9Z1P3_MCL1-01          -----------------EFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLI
A5PJR2_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A452GAH0_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
G1L3M8_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
F7AVA6_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
G1T2Q0_MCL1-02          -----------------EFFHVEDLESGIRNVLLAFAGVAGVGAGLAYLI
G1T2Q0_MCL1-01          -----------------EFFHVEDLESGIRNVLLAFAGVAGVGAGLAYLI
M3XAP4_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
Q7YRZ9_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
J9PBC4_MCL1-02          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
Q8HYS5_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
M3XZZ5_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A452RHX5_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
H0XFB7_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K6GI15_MCL1-02      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
F7GTF7_MCL1-02          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K5CFH3_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLALSL
A0A2K6V5Y3_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K6KRW9_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K6PPL1_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K5XSC7_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A0D9RZP5_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K5W0W9_MCL1-02      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
I7G687_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
F7HUE9_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K6ECR0_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2I3M3D6_MCL1-02      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K5LXU8_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAVAGVAGVGAGLAYLI
A0A2I3GB35_MCL1-02      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
H2N5Y9_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
Q07820_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2R9BYH6_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
K7DE58_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2I2YQH7_MCL1-01      -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2K5I9Q7_MCL1-02      ----------------------------------------GISNQIALL-
M3XAP4_MCL1-02          ----------------------------------------GISNKIAF--
A0A2K6GI15_MCL1-01      ----------------------------------------GISNKIAL--
F7GTF7_MCL1-01          ----------------------------------------GISNKIALE-
A0A2K5CFH3_MCL1-03      ----------------------------------------G---------
A0A2K6V5Y3_MCL1-02      ----------------------------------------GISNKIAL--
A0A2K6KRW9_MCL1-02      ----------------------------------------GISNKIALL-
A0A2K6PPL1_MCL1-02      ----------------------------------------GISNKIALL-
A0A2K5LXU8_MCL1-02      ----------------------------------------GISNKIALL-
A0A2K5W0W9_MCL1-01      ----------------------------------------GISNKIALL-
A0A2K6ECR0_MCL1-02      ----------------------------------------GISNKIALL-
A0A2I3M3D6_MCL1-01      ----------------------------------------GISNKIALL-
A0A2K5XSC7_MCL1-02      ----------------------------------------GISNKIALL-
A0A2I3GB35_MCL1-01      ----------------------------------------GISNKIALL-
Q07820_MCL1-03          ----------------------------------------GISNKIALL-
A0A2R9BYH6_MCL1-02      ----------------------------------------GISNKIALL-
K7DE58_MCL1-02          ----------------------------------------GISNKIALL-
A0A2I2YQH7_MCL1-02      ----------------------------------------GISNKIALL-
G3WBC5_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
W5QI41_MCL1-01          -----------------EFFRVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
F1MQX4_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
B4DLY8_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
B4DG83_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
B4E3L8_MCL1-01          -----------------EFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
G3PJT0_MCL1-01          -----------------EFFRVADPESAVRNTLMAVAGFASIGATLALLI
A0A3Q3VP02_MCL1-01      -----------------EFFRVADPESTVRNALMTIAGVAGIGATLALLI
A0A3B5K5B3_MCL1-01      -----------------EFFQVSDPESSVRNMLMAVAGVAGLGATLALLI
H2MLZ3_MCL1-01          -----------------EFFRVSDPETTVRNTLVAFLGIAGVGALLAQL-
H2MLZ3_MCL1-02          -----------------EFFRVSDPETTVRNTLVAFLGIAGVGALLAQLN
A0A3B3CEX1_MCL1-02      -----------------EFFHVPDPESTVRNTLVAVLGLAGVGALLAQV-
A0A3B3CEX1_MCL1-01      -----------------EFFHVPDPESTVRNTLVAVLGLAGVGALLAQVQ
A0A3Q3B4V7_MCL1-01      -----------------EFFRITDPESTVRNTLMAVAGFAGLGATLALLI
A0A3Q3B4V7_MCL1-02      -----------------EFFRITDPESTVRNTLMAVAGFAGLGATLALLI
A0A3Q2EDX8_MCL1-01      -----------------EFFRVEDPEATMRNTLMAFVGVAGIGATLAFLI
A0A3Q2T2A9_MCL1-02      -----------------EFFKVEDTESTVRNTLMAFVGVAGIGAGLAFLI
A0A3Q2T2A9_MCL1-01      -----------------EFFKVEDTESTVRNTLMAFVGVAGIGAGLAFLI
A0A3B5PQ55_MCL1-02      -----------------EFFRVSDPESTVRNTLMAVVGVAGIGATLAFLI
A0A3B5PQ55_MCL1-01      -----------------EFFRVSDPESTVRNTLMAVVGVAGIGATLAFLI
A0A3P9Q4R7_MCL1-02      -----------------EFFRVSDPESTVRNTLMAFVGVAGIGATLAFLI
A0A3P9Q4R7_MCL1-01      -----------------EFFRVSDPESTVRNTLMAFVGVAGIGATLAFLI
A0A087X830_MCL1-01      -----------------EFFRVSDPESTVRNTLMAFVGVAGIGATLAFLI
A0A3B3YCD0_MCL1-01      -----------------EFFRVSDPESTVRNTLMAFVGVAGIGATLAFLI
A0A3P8VKS9_MCL1-02      -----------------EFFRVEDPEATMRNTLLGLFGVAGLGATLALLI
A0A3P8VKS9_MCL1-01      -----------------EFFRVEDPEATMRNTLLGLFGVAGLGATLALLI
A0A3P8VKS9_MCL1-05      -----------------EFFRVEDPEATMRNTLLGLFGVAGLGATLALLI
A0A3P8VKS9_MCL1-04      -----------------EFFRVEDPEATMRNTLLGLFGVAGLGATLALLI
A0A3P8VKS9_MCL1-03      -----------------EFFRVEDPEATMRNTLLGLFGVAGLGATLALLI
I3JHR5_MCL1-01          -----------------EFFRVADPESTVRNTLMAFAGFAGIGATLALLI
A0A3Q4HLQ8_MCL1-01      -----------------EFFRVADPESIVRHTLMAFAGFAGIGATLALLI
A0A3P8NP63_MCL1-02      -----------------EFFRVADPESIVRHTLMAFAGFAGIGATLALLI
A0A3P8NP63_MCL1-03      -----------------EFFRVADPESIVRHTLMAFAGFAGIGATLALLI
A0A3Q2VNL8_MCL1-01      -----------------EFFRVADPESIVRHTLMAFAGFAGIGATLALLI
A0A3P8NP63_MCL1-01      -----------------EFFRVADPESIVRHTLMAFAGFAGIGATLALLI
A0A3P9BVM3_MCL1-01      -----------------EFFRVADPESIVRHTLMAFAGFAGIGATLALLI
A0A3B4G4Z6_MCL1-01      -----------------EFFRVADPESIVRHTLMAFAGFAGIGATLALLI
A0A2U9CJ81_MCL1-01      -----------------EFFRVADPETTMRNTLIGLAGFAGVGATLALLI
A0A3Q3IZW0_MCL1-01      -----------------EFFRVADPESTVRTTLMAFAGFAGIGATLALLI
A0A3Q1GX28_MCL1-02      -----------------EFFRVADPESTVRKSLMAFAGLAGIGASLALLI
A0A3Q1GX28_MCL1-01      -----------------EFFRVADPESTVRKSLMAFAGLAGIGASLALLI
A0A3B4XKA5_MCL1-01      -----------------SFFRVADPESKVRNTLMAFAGFAGIGATLALLI
A0A3Q3GP42_MCL1-01      -----------------EFFRVADPESTVRTTLMAFAGFAGIGATLALLI
A0A3Q3M6G2_MCL1-02      -----------------EFFRVADPESTVRHTLMAVAGVAGLGATLALLI
A0A3Q3M6G2_MCL1-01      -----------------EFFRVADPESTVRHTLMAVAGVAGLGATLALLI
A0A3B1IEV7_MCL1-01      -----------------EFFREDDSESRVRNALMAFAGFAGLGAGLALLM
A0A3B4E3I4_MCL1-03      -----------------EFFREDDSESRVRNALMAFAGFAGLGAGLALLM
A0A3B4E3I4_MCL1-02      -----------------EFFREDDSESRVRNALMAFAGFAGLGAGLALLM
A0A3B4E3I4_MCL1-01      -----------------EFFREDDSESRVRNALMAFAGFAGLGAGLALLM
A0A3B4AFB7_MCL1-01      -----------------DFFRVEDPESAVRNTLMAVAGLAGIGATLAMLI
Q8UWD6_MCL1-01          -----------------EFFHVPDTEAAVRNTLLTIGSVATLSAALAYWI
F8W4Q8_MCL1-01          -----------------EFFHVPDTEAAVRNTLLTIGGVATLSAALAYWI
Q568W5_MCL1-01          -----------------EFFHVPDTEAAVRNTLLTIGGVATLSAALAYWI
A0A3B1K5R1_MCL1-01      -----------------EFFRVPDPESTMRNALMAFVTVAGLGASIAFLA
A0A3B4C6H5_MCL1-01      -----------------EFFHVPDPESKMRNALMALVTAAGVGAGLVLLS
A0A3B4C6H5_MCL1-02      -----------------EFFHVPDPESKMRNALMALVTAAGVGAGLVLLS
A0A3B4C6H5_MCL1-03      -----------------EFFHVPDPESKMRNALMALVTAAGVGAGLVLLS
Q568V1_MCL1-01          -----------------EFFHQEDVESVVRHGLLALVGCAGIGAGLAFLI
Q1L8X3_MCL1-01          -----------------EFFHQEDVESVVRHGLLALVGCAGIGAGLAFLI
Q9I9N3_MCL1-01          -----------------EFFHQEDVESVVRHGLLALVGCAGIGAGLAFLI
W5MMB7_MCL1-01          -----------------EFFRVEDPESTIRNALMAFAGVAGLGAGLALLI
A0A3B3R4U0_MCL1-01      -----------------DFFYMEDPESTVRNALVAFAGVASLGAGLALLM
A0A3B3SG34_MCL1-01      -----------------EFFHVEDTESLVLQKVLVHVSECGSFELHDLKA
A0A3Q2Y539_MCL1-01      -----------------EFFKEDDLESTVRNGLFAFVGLVSVTAALRCLI
Q4SW32_MCL1-01          -----------------EFFQVPDPESTVRTVLMAVAGVAGIGAKLALLI
D2ITA0_MCL1-03          -----------------EFFRVSDPETTVRNTLMAFAGFAGIGATIALLI
D2ITA0_MCL1-04          -----------------EFFRVSDPETTVRNTLMAFAGFAGIGATIALLI
Q0KFR9_MCL1-01          -----------------EFFHVQDPESSVRNTLLAFAGVAGIGATLAMFI
A0A3P8Y1W8_MCL1-01      -----------------EFFHVEDPESSVRNTLMAFAGVAGIGATLALLI
A0A3P8Y1W8_MCL1-02      -----------------EFFHVEDPESS------------PIGLFLQVF-
A0A3Q2XZL8_MCL1-01      -----------------QFFREVDPESTVRNTLMAFAGVAGIGATLALLI
A0A3B4AFB7_MCL1-02      -----------------DFFRVEDPESAVRNTLMAVAGLAGIGATLAMLI
A0A3B3VM25_MCL1-01      -----------------EFFRVSDPESTVRNTLMAFVGVAGIGATLAFLI
A0A3Q0RA11_MCL1-03      -----------------EFFRVADPESTVRNTLMAFAGFAGIGATLALLI
A0A3Q0RA11_MCL1-01      -----------------EFFRVADPESTVRNTLMAFAGFAGIGATLALLI
A0A3B4T8L9_MCL1-02      -----------------AFFRVADPESKVRNTLMAFAGFAGIGATLALLI
A0A3B4T8L9_MCL1-01      -----------------AFFRVADPESKVRNTLMAFAGFAGIGATLALLI
A0A3Q1EQB9_MCL1-02      -----------------EFFRVADPELTVRNTLMAFAGFAGIGATLALLI
A0A3B4ZKP6_MCL1-01      -----------------EFFRVADPELTVRNTLMAFAGFAGIGATLALLI
A0A3Q1BKL8_MCL1-02      -----------------EFFRVADPELTVRNTLMAFAGFAGIGATLALLI
A0A3Q1EQB9_MCL1-01      -----------------EFFRVADPELTVRNTLMAFAGFAGIGATLALLI
A0A3Q1BKL8_MCL1-01      -----------------EFFRVADPELTVRNTLMAFAGFAGIGATLALLI
A0A3P8RQX7_MCL1-02      -----------------EFFRVADPELTVRNTLMAFAGFAGIGATLALLI
A0A3P8RQX7_MCL1-01      -----------------EFFRVADPELTVRNTLMAFAGFAGIGATLALLI
                                                                          

A0A3Q0RA11_MCL1-02      R-------------------------------------------------
I3KXG5_MCL1-01          R-------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          R-------------------------------------------------
K7FPN7_MCL1-01          R-------------------------------------------------
F8W4Q8_MCL1-02          R-------------------------------------------------
A0A2K5DMS4_MCL1-01      R-------------------------------------------------
A0A3P8V8T6_MCL1-01      RYFLRFVW------------------------------------------
B6V6J0_MCL1-01          R-------------------------------------------------
F7ETY1_MCL1-01          R-------------------------------------------------
H3AR18_MCL1-02          R-------------------------------------------------
H3AR18_MCL1-01          R-------------------------------------------------
J7H260_MCL1-01          R-------------------------------------------------
H0XHA5_MCL1-01          R-------------------------------------------------
R4GAJ0_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-02          R-------------------------------------------------
G1QAV8_MCL1-01          R-------------------------------------------------
A0A2K6F6N9_MCL1-01      R-------------------------------------------------
M3XAP4_MCL1-03          R-------------------------------------------------
A0A2K6GI15_MCL1-03      R-------------------------------------------------
C8YZ26_MCL1-01          R-------------------------------------------------
A0A2K5CFH3_MCL1-02      IHI-----------------------------------------------
F7GTF7_MCL1-03          R-------------------------------------------------
A0A2K6V5Y3_MCL1-03      R-------------------------------------------------
A0A2K5LXU8_MCL1-03      R-------------------------------------------------
A0A2K5I9Q7_MCL1-03      R-------------------------------------------------
A0A2I2YQH7_MCL1-03      R-------------------------------------------------
Q07820_MCL1-04          R-------------------------------------------------
A0A2K5W0W9_MCL1-03      R-------------------------------------------------
F7HUE9_MCL1-02          R-------------------------------------------------
A0A2K6ECR0_MCL1-03      R-------------------------------------------------
A0A2K5XSC7_MCL1-03      R-------------------------------------------------
A0A2R9BYH6_MCL1-03      R-------------------------------------------------
K7DE58_MCL1-03          R-------------------------------------------------
A0A2I3M3D6_MCL1-03      R-------------------------------------------------
A0A2K6KRW9_MCL1-03      R-------------------------------------------------
A0A2K6PPL1_MCL1-03      R-------------------------------------------------
K7DE58_MCL1-04          R-------------------------------------------------
A0A2I3GB35_MCL1-03      R-------------------------------------------------
G2HFR3_MCL1-01          R-------------------------------------------------
A0A1L1RNM6_MCL1-01      RKWRS---------------------------------------------
A0A1L1RNM6_MCL1-02      R-------------------------------------------------
F6ZMX1_MCL1-01          R-------------------------------------------------
A0A286Y1M5_MCL1-01      R-------------------------------------------------
P97287_MCL1-02          R-------------------------------------------------
P97287_MCL1-01          R-------------------------------------------------
G3T756_MCL1-01          R-------------------------------------------------
G1L3M8_MCL1-02          R-------------------------------------------------
A0A2U3V2H3_MCL1-01      R-------------------------------------------------
K9IWB2_MCL1-03          --------------------------------------------------
K9IWB2_MCL1-02          R-------------------------------------------------
K9IWB2_MCL1-01          R-------------------------------------------------
B4DU51_MCL1-01          R-------------------------------------------------
A0A287DCH9_MCL1-02      R-------------------------------------------------
A0A287DCH9_MCL1-01      R-------------------------------------------------
A0A452GAH0_MCL1-02      R-------------------------------------------------
A0A2K5I9Q7_MCL1-01      R-------------------------------------------------
G1PZ39_MCL1-01          R-------------------------------------------------
Q95KR3_MCL1-01          R-------------------------------------------------
A0A2K5EPY9_MCL1-02      R-------------------------------------------------
A0A2K5EPY9_MCL1-01      R-------------------------------------------------
J9PBC4_MCL1-01          AKR-----------------------------------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          R-------------------------------------------------
A5PJR2_MCL1-01          R-------------------------------------------------
A0A452GAH0_MCL1-01      R-------------------------------------------------
G1L3M8_MCL1-01          R-------------------------------------------------
F7AVA6_MCL1-01          R-------------------------------------------------
G1T2Q0_MCL1-02          R-------------------------------------------------
G1T2Q0_MCL1-01          R-------------------------------------------------
M3XAP4_MCL1-01          R-------------------------------------------------
Q7YRZ9_MCL1-01          R-------------------------------------------------
J9PBC4_MCL1-02          R-------------------------------------------------
Q8HYS5_MCL1-01          R-------------------------------------------------
M3XZZ5_MCL1-01          R-------------------------------------------------
A0A452RHX5_MCL1-01      R-------------------------------------------------
H0XFB7_MCL1-01          R-------------------------------------------------
A0A2K6GI15_MCL1-02      R-------------------------------------------------
F7GTF7_MCL1-02          R-------------------------------------------------
A0A2K5CFH3_MCL1-01      IHI-----------------------------------------------
A0A2K6V5Y3_MCL1-01      R-------------------------------------------------
A0A2K6KRW9_MCL1-01      R-------------------------------------------------
A0A2K6PPL1_MCL1-01      R-------------------------------------------------
A0A2K5XSC7_MCL1-01      R-------------------------------------------------
A0A0D9RZP5_MCL1-01      R-------------------------------------------------
A0A2K5W0W9_MCL1-02      R-------------------------------------------------
I7G687_MCL1-01          R-------------------------------------------------
F7HUE9_MCL1-01          R-------------------------------------------------
A0A2K6ECR0_MCL1-01      R-------------------------------------------------
A0A2I3M3D6_MCL1-02      R-------------------------------------------------
A0A2K5LXU8_MCL1-01      R-------------------------------------------------
A0A2I3GB35_MCL1-02      R-------------------------------------------------
H2N5Y9_MCL1-01          R-------------------------------------------------
Q07820_MCL1-01          R-------------------------------------------------
A0A2R9BYH6_MCL1-01      R-------------------------------------------------
K7DE58_MCL1-01          R-------------------------------------------------
A0A2I2YQH7_MCL1-01      R-------------------------------------------------
A0A2K5I9Q7_MCL1-02      --------------------------------------------------
M3XAP4_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K6V5Y3_MCL1-02      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPL1_MCL1-02      --------------------------------------------------
A0A2K5LXU8_MCL1-02      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3M3D6_MCL1-01      --------------------------------------------------
A0A2K5XSC7_MCL1-02      --------------------------------------------------
A0A2I3GB35_MCL1-01      --------------------------------------------------
Q07820_MCL1-03          --------------------------------------------------
A0A2R9BYH6_MCL1-02      --------------------------------------------------
K7DE58_MCL1-02          --------------------------------------------------
A0A2I2YQH7_MCL1-02      --------------------------------------------------
G3WBC5_MCL1-01          R-------------------------------------------------
W5QI41_MCL1-01          R-------------------------------------------------
F1MQX4_MCL1-01          R-------------------------------------------------
B4DLY8_MCL1-01          R-------------------------------------------------
B4DG83_MCL1-01          R-------------------------------------------------
B4E3L8_MCL1-01          R-------------------------------------------------
G3PJT0_MCL1-01          SGPSKVQRQLLTIELLQIVRSQRGGHRLQRDVSTRPSPTSGSGL------
A0A3Q3VP02_MCL1-01      R-------------------------------------------------
A0A3B5K5B3_MCL1-01      R-------------------------------------------------
H2MLZ3_MCL1-01          ----------------SR--------------------------------
H2MLZ3_MCL1-02          MMAIFKGLPASTRLHNSR--------------------------------
A0A3B3CEX1_MCL1-02      -----------CR-------------------------------------
A0A3B3CEX1_MCL1-01      GPYRIWQDMTSCHTNLSKNKVGRSPSFAVEGP------------------
A0A3Q3B4V7_MCL1-01      SV------------------------------------------------
A0A3Q3B4V7_MCL1-02      STWSAKCEHRPLENESCVSLAPGIRSCYLSTTTHLSWAAEIWAAGVDQQD
A0A3Q2EDX8_MCL1-01      R-------------------------------------------------
A0A3Q2T2A9_MCL1-02      R-------------------------------------------------
A0A3Q2T2A9_MCL1-01      RNSIKISFIGQDCSWAFTSPPTFPGL------------------------
A0A3B5PQ55_MCL1-02      -----SF-------------------------------------------
A0A3B5PQ55_MCL1-01      RRCKEKY-------------------------------------------
A0A3P9Q4R7_MCL1-02      R-------------------------------------------------
A0A3P9Q4R7_MCL1-01      SK------------------------------------------------
A0A087X830_MCL1-01      R-------------------------------------------------
A0A3B3YCD0_MCL1-01      R-------------------------------------------------
A0A3P8VKS9_MCL1-02      RDFNSIGKAFTVAFDAMFLFIRR---------------------------
A0A3P8VKS9_MCL1-01      RSRK----------------------------------------------
A0A3P8VKS9_MCL1-05      RWK-----------------------------------------------
A0A3P8VKS9_MCL1-04      R-------------------------------------------------
A0A3P8VKS9_MCL1-03      R-------------------------------------------------
I3JHR5_MCL1-01          RFWDALL-------------------------------------------
A0A3Q4HLQ8_MCL1-01      R-------------------------------------------------
A0A3P8NP63_MCL1-02      RSSTIF--------------------------------------------
A0A3P8NP63_MCL1-03      SGL-----------------------------------------------
A0A3Q2VNL8_MCL1-01      SGL-----------------------------------------------
A0A3P8NP63_MCL1-01      SCWDALL-------------------------------------------
A0A3P9BVM3_MCL1-01      SCWDALL-------------------------------------------
A0A3B4G4Z6_MCL1-01      SCWDALL-------------------------------------------
A0A2U9CJ81_MCL1-01      R-------------------------------------------------
A0A3Q3IZW0_MCL1-01      RTNNTCGGLKRKWSRASPW-------------------------------
A0A3Q1GX28_MCL1-02      SAVRLQPLHLH---------------------------------------
A0A3Q1GX28_MCL1-01      SSCSVM--------------------------------------------
A0A3B4XKA5_MCL1-01      SAMM----------------------------------------------
A0A3Q3GP42_MCL1-01      R-------------------------------------------------
A0A3Q3M6G2_MCL1-02      SYCGVM--------------------------------------------
A0A3Q3M6G2_MCL1-01      SRNNKMLTSQSAISAPVSA-------------------------------
A0A3B1IEV7_MCL1-01      R-------------------------------------------------
A0A3B4E3I4_MCL1-03      R-------------------------------------------------
A0A3B4E3I4_MCL1-02      R-------------------------------------------------
A0A3B4E3I4_MCL1-01      R-------------------------------------------------
A0A3B4AFB7_MCL1-01      R-------------------------------------------------
Q8UWD6_MCL1-01          R-------------------------------------------------
F8W4Q8_MCL1-01          R-------------------------------------------------
Q568W5_MCL1-01          R-------------------------------------------------
A0A3B1K5R1_MCL1-01      R-------------------------------------------------
A0A3B4C6H5_MCL1-01      R-------------------------------------------------
A0A3B4C6H5_MCL1-02      R-------------------------------------------------
A0A3B4C6H5_MCL1-03      R-------------------------------------------------
Q568V1_MCL1-01          R-------------------------------------------------
Q1L8X3_MCL1-01          R-------------------------------------------------
Q9I9N3_MCL1-01          R-------------------------------------------------
W5MMB7_MCL1-01          R-------------------------------------------------
A0A3B3R4U0_MCL1-01      R-------------------------------------------------
A0A3B3SG34_MCL1-01      LCM-----------------------------------------------
A0A3Q2Y539_MCL1-01      R-------------------------------------------------
Q4SW32_MCL1-01          R-------------------------------------------------
D2ITA0_MCL1-03          R-------------------------------------------------
D2ITA0_MCL1-04          R-------------------------------------------------
Q0KFR9_MCL1-01          R-------------------------------------------------
A0A3P8Y1W8_MCL1-01      R-------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      R-------------------------------------------------
A0A3B4AFB7_MCL1-02      R-------------------------------------------------
A0A3B3VM25_MCL1-01      RKLRSALGQQKLNTSLLEMRDCTSLEPG----------------------
A0A3Q0RA11_MCL1-03      R-------------------------------------------------
A0A3Q0RA11_MCL1-01      R-------------------------------------------------
A0A3B4T8L9_MCL1-02      RCLFERSRPKQEGKIAFFPMSCSREAHFHRAHS-----------------
A0A3B4T8L9_MCL1-01      SAMM----------------------------------------------
A0A3Q1EQB9_MCL1-02      RLESKFGETQRTGRGAGGKRWIQGGRRKPQERNRRRHDACRDRGRGQGNR
A0A3B4ZKP6_MCL1-01      RS------------------------------------------------
A0A3Q1BKL8_MCL1-02      SGLAAVGLTQSTENSCKDAHISCCR-------------------------
A0A3Q1EQB9_MCL1-01      R-------------------------------------------------
A0A3Q1BKL8_MCL1-01      R-------------------------------------------------
A0A3P8RQX7_MCL1-02      R-------------------------------------------------
A0A3P8RQX7_MCL1-01      R-------------------------------------------------
                                                                          

A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
F7ETY1_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-02          --------------------------------------------------
G1QAV8_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-03          --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSC7_MCL1-03      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-02      --------------------------------------------------
F6ZMX1_MCL1-01          --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-02          --------------------------------------------------
P97287_MCL1-01          --------------------------------------------------
G3T756_MCL1-01          --------------------------------------------------
G1L3M8_MCL1-02          --------------------------------------------------
A0A2U3V2H3_MCL1-01      --------------------------------------------------
K9IWB2_MCL1-03          --------------------------------------------------
K9IWB2_MCL1-02          --------------------------------------------------
K9IWB2_MCL1-01          --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      --------------------------------------------------
A0A452GAH0_MCL1-02      --------------------------------------------------
A0A2K5I9Q7_MCL1-01      --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          --------------------------------------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A452GAH0_MCL1-01      --------------------------------------------------
G1L3M8_MCL1-01          --------------------------------------------------
F7AVA6_MCL1-01          --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
M3XAP4_MCL1-01          --------------------------------------------------
Q7YRZ9_MCL1-01          --------------------------------------------------
J9PBC4_MCL1-02          --------------------------------------------------
Q8HYS5_MCL1-01          --------------------------------------------------
M3XZZ5_MCL1-01          --------------------------------------------------
A0A452RHX5_MCL1-01      --------------------------------------------------
H0XFB7_MCL1-01          --------------------------------------------------
A0A2K6GI15_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5CFH3_MCL1-01      --------------------------------------------------
A0A2K6V5Y3_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K6PPL1_MCL1-01      --------------------------------------------------
A0A2K5XSC7_MCL1-01      --------------------------------------------------
A0A0D9RZP5_MCL1-01      --------------------------------------------------
A0A2K5W0W9_MCL1-02      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
F7HUE9_MCL1-01          --------------------------------------------------
A0A2K6ECR0_MCL1-01      --------------------------------------------------
A0A2I3M3D6_MCL1-02      --------------------------------------------------
A0A2K5LXU8_MCL1-01      --------------------------------------------------
A0A2I3GB35_MCL1-02      --------------------------------------------------
H2N5Y9_MCL1-01          --------------------------------------------------
Q07820_MCL1-01          --------------------------------------------------
A0A2R9BYH6_MCL1-01      --------------------------------------------------
K7DE58_MCL1-01          --------------------------------------------------
A0A2I2YQH7_MCL1-01      --------------------------------------------------
A0A2K5I9Q7_MCL1-02      --------------------------------------------------
M3XAP4_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K6V5Y3_MCL1-02      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPL1_MCL1-02      --------------------------------------------------
A0A2K5LXU8_MCL1-02      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3M3D6_MCL1-01      --------------------------------------------------
A0A2K5XSC7_MCL1-02      --------------------------------------------------
A0A2I3GB35_MCL1-01      --------------------------------------------------
Q07820_MCL1-03          --------------------------------------------------
A0A2R9BYH6_MCL1-02      --------------------------------------------------
K7DE58_MCL1-02          --------------------------------------------------
A0A2I2YQH7_MCL1-02      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
H2MLZ3_MCL1-01          --------------------------------------------------
H2MLZ3_MCL1-02          --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-01      ---------------CWP--------------------------------
A0A3Q3B4V7_MCL1-02      ESNLNIGWILPLHNDCWRQAPAPCVSAGKRE-------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2T2A9_MCL1-02      --------------------------------------------------
A0A3Q2T2A9_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4R7_MCL1-02      --------------------------------------------------
A0A3P9Q4R7_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-02      --------------------------------------------------
A0A3P8VKS9_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-05      --------------------------------------------------
A0A3P8VKS9_MCL1-04      --------------------------------------------------
A0A3P8VKS9_MCL1-03      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3P8NP63_MCL1-03      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4E3I4_MCL1-03      --------------------------------------------------
A0A3B4E3I4_MCL1-02      --------------------------------------------------
A0A3B4E3I4_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-02      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0RA11_MCL1-03      --------------------------------------------------
A0A3Q0RA11_MCL1-01      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      QNWRVPRRGNQEGHGAGRGPRRKQGDRLGRSGPDSGILQERRTEKKTLVS
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
                                                                          

A0A3Q0RA11_MCL1-02      -----
I3KXG5_MCL1-01          -----
U3KKY6_MCL1-01          -----
G1MPY7_MCL1-01          -----
K7FPN7_MCL1-01          -----
F8W4Q8_MCL1-02          -----
A0A2K5DMS4_MCL1-01      -----
A0A3P8V8T6_MCL1-01      -----
B6V6J0_MCL1-01          -----
F7ETY1_MCL1-01          -----
H3AR18_MCL1-02          -----
H3AR18_MCL1-01          -----
J7H260_MCL1-01          -----
H0XHA5_MCL1-01          -----
R4GAJ0_MCL1-01          -----
R4GAJ0_MCL1-02          -----
G1QAV8_MCL1-01          -----
A0A2K6F6N9_MCL1-01      -----
M3XAP4_MCL1-03          -----
A0A2K6GI15_MCL1-03      -----
C8YZ26_MCL1-01          -----
A0A2K5CFH3_MCL1-02      -----
F7GTF7_MCL1-03          -----
A0A2K6V5Y3_MCL1-03      -----
A0A2K5LXU8_MCL1-03      -----
A0A2K5I9Q7_MCL1-03      -----
A0A2I2YQH7_MCL1-03      -----
Q07820_MCL1-04          -----
A0A2K5W0W9_MCL1-03      -----
F7HUE9_MCL1-02          -----
A0A2K6ECR0_MCL1-03      -----
A0A2K5XSC7_MCL1-03      -----
A0A2R9BYH6_MCL1-03      -----
K7DE58_MCL1-03          -----
A0A2I3M3D6_MCL1-03      -----
A0A2K6KRW9_MCL1-03      -----
A0A2K6PPL1_MCL1-03      -----
K7DE58_MCL1-04          -----
A0A2I3GB35_MCL1-03      -----
G2HFR3_MCL1-01          -----
A0A1L1RNM6_MCL1-01      -----
A0A1L1RNM6_MCL1-02      -----
F6ZMX1_MCL1-01          -----
A0A286Y1M5_MCL1-01      -----
P97287_MCL1-02          -----
P97287_MCL1-01          -----
G3T756_MCL1-01          -----
G1L3M8_MCL1-02          -----
A0A2U3V2H3_MCL1-01      -----
K9IWB2_MCL1-03          -----
K9IWB2_MCL1-02          -----
K9IWB2_MCL1-01          -----
B4DU51_MCL1-01          -----
A0A287DCH9_MCL1-02      -----
A0A287DCH9_MCL1-01      -----
A0A452GAH0_MCL1-02      -----
A0A2K5I9Q7_MCL1-01      -----
G1PZ39_MCL1-01          -----
Q95KR3_MCL1-01          -----
A0A2K5EPY9_MCL1-02      -----
A0A2K5EPY9_MCL1-01      -----
J9PBC4_MCL1-01          -----
A0A2K5C7L5_MCL1-01      -----
Q9Z1P3_MCL1-01          -----
A5PJR2_MCL1-01          -----
A0A452GAH0_MCL1-01      -----
G1L3M8_MCL1-01          -----
F7AVA6_MCL1-01          -----
G1T2Q0_MCL1-02          -----
G1T2Q0_MCL1-01          -----
M3XAP4_MCL1-01          -----
Q7YRZ9_MCL1-01          -----
J9PBC4_MCL1-02          -----
Q8HYS5_MCL1-01          -----
M3XZZ5_MCL1-01          -----
A0A452RHX5_MCL1-01      -----
H0XFB7_MCL1-01          -----
A0A2K6GI15_MCL1-02      -----
F7GTF7_MCL1-02          -----
A0A2K5CFH3_MCL1-01      -----
A0A2K6V5Y3_MCL1-01      -----
A0A2K6KRW9_MCL1-01      -----
A0A2K6PPL1_MCL1-01      -----
A0A2K5XSC7_MCL1-01      -----
A0A0D9RZP5_MCL1-01      -----
A0A2K5W0W9_MCL1-02      -----
I7G687_MCL1-01          -----
F7HUE9_MCL1-01          -----
A0A2K6ECR0_MCL1-01      -----
A0A2I3M3D6_MCL1-02      -----
A0A2K5LXU8_MCL1-01      -----
A0A2I3GB35_MCL1-02      -----
H2N5Y9_MCL1-01          -----
Q07820_MCL1-01          -----
A0A2R9BYH6_MCL1-01      -----
K7DE58_MCL1-01          -----
A0A2I2YQH7_MCL1-01      -----
A0A2K5I9Q7_MCL1-02      -----
M3XAP4_MCL1-02          -----
A0A2K6GI15_MCL1-01      -----
F7GTF7_MCL1-01          -----
A0A2K5CFH3_MCL1-03      -----
A0A2K6V5Y3_MCL1-02      -----
A0A2K6KRW9_MCL1-02      -----
A0A2K6PPL1_MCL1-02      -----
A0A2K5LXU8_MCL1-02      -----
A0A2K5W0W9_MCL1-01      -----
A0A2K6ECR0_MCL1-02      -----
A0A2I3M3D6_MCL1-01      -----
A0A2K5XSC7_MCL1-02      -----
A0A2I3GB35_MCL1-01      -----
Q07820_MCL1-03          -----
A0A2R9BYH6_MCL1-02      -----
K7DE58_MCL1-02          -----
A0A2I2YQH7_MCL1-02      -----
G3WBC5_MCL1-01          -----
W5QI41_MCL1-01          -----
F1MQX4_MCL1-01          -----
B4DLY8_MCL1-01          -----
B4DG83_MCL1-01          -----
B4E3L8_MCL1-01          -----
G3PJT0_MCL1-01          -----
A0A3Q3VP02_MCL1-01      -----
A0A3B5K5B3_MCL1-01      -----
H2MLZ3_MCL1-01          -----
H2MLZ3_MCL1-02          -----
A0A3B3CEX1_MCL1-02      -----
A0A3B3CEX1_MCL1-01      -----
A0A3Q3B4V7_MCL1-01      -----
A0A3Q3B4V7_MCL1-02      -----
A0A3Q2EDX8_MCL1-01      -----
A0A3Q2T2A9_MCL1-02      -----
A0A3Q2T2A9_MCL1-01      -----
A0A3B5PQ55_MCL1-02      -----
A0A3B5PQ55_MCL1-01      -----
A0A3P9Q4R7_MCL1-02      -----
A0A3P9Q4R7_MCL1-01      -----
A0A087X830_MCL1-01      -----
A0A3B3YCD0_MCL1-01      -----
A0A3P8VKS9_MCL1-02      -----
A0A3P8VKS9_MCL1-01      -----
A0A3P8VKS9_MCL1-05      -----
A0A3P8VKS9_MCL1-04      -----
A0A3P8VKS9_MCL1-03      -----
I3JHR5_MCL1-01          -----
A0A3Q4HLQ8_MCL1-01      -----
A0A3P8NP63_MCL1-02      -----
A0A3P8NP63_MCL1-03      -----
A0A3Q2VNL8_MCL1-01      -----
A0A3P8NP63_MCL1-01      -----
A0A3P9BVM3_MCL1-01      -----
A0A3B4G4Z6_MCL1-01      -----
A0A2U9CJ81_MCL1-01      -----
A0A3Q3IZW0_MCL1-01      -----
A0A3Q1GX28_MCL1-02      -----
A0A3Q1GX28_MCL1-01      -----
A0A3B4XKA5_MCL1-01      -----
A0A3Q3GP42_MCL1-01      -----
A0A3Q3M6G2_MCL1-02      -----
A0A3Q3M6G2_MCL1-01      -----
A0A3B1IEV7_MCL1-01      -----
A0A3B4E3I4_MCL1-03      -----
A0A3B4E3I4_MCL1-02      -----
A0A3B4E3I4_MCL1-01      -----
A0A3B4AFB7_MCL1-01      -----
Q8UWD6_MCL1-01          -----
F8W4Q8_MCL1-01          -----
Q568W5_MCL1-01          -----
A0A3B1K5R1_MCL1-01      -----
A0A3B4C6H5_MCL1-01      -----
A0A3B4C6H5_MCL1-02      -----
A0A3B4C6H5_MCL1-03      -----
Q568V1_MCL1-01          -----
Q1L8X3_MCL1-01          -----
Q9I9N3_MCL1-01          -----
W5MMB7_MCL1-01          -----
A0A3B3R4U0_MCL1-01      -----
A0A3B3SG34_MCL1-01      -----
A0A3Q2Y539_MCL1-01      -----
Q4SW32_MCL1-01          -----
D2ITA0_MCL1-03          -----
D2ITA0_MCL1-04          -----
Q0KFR9_MCL1-01          -----
A0A3P8Y1W8_MCL1-01      -----
A0A3P8Y1W8_MCL1-02      -----
A0A3Q2XZL8_MCL1-01      -----
A0A3B4AFB7_MCL1-02      -----
A0A3B3VM25_MCL1-01      -----
A0A3Q0RA11_MCL1-03      -----
A0A3Q0RA11_MCL1-01      -----
A0A3B4T8L9_MCL1-02      -----
A0A3B4T8L9_MCL1-01      -----
A0A3Q1EQB9_MCL1-02      EILVT
A0A3B4ZKP6_MCL1-01      -----
A0A3Q1BKL8_MCL1-02      -----
A0A3Q1EQB9_MCL1-01      -----
A0A3Q1BKL8_MCL1-01      -----
A0A3P8RQX7_MCL1-02      -----
A0A3P8RQX7_MCL1-01      -----
                             

© 1998-2019