Dataset for protein BCL-2-like of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

731 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A3Q1GS47_BCL2L1-      MFRRHVKASYYVIGRQGRADVGGYVRAHTLVNTKWMCDILVELDSFLCAP
A0A2K5DMS4_MCL1-01      --------------------MFG---FQVVIRLNLYCGAI----------
A0A3P8V8T6_MCL1-01      ------------------------------LDMVLISSVC----------
B6V6J0_MCL1-01          -------------MMHQSVIAKQRPSTSFLIPCQFYCSGG----------
F7ETY1_MCL1-01          -------------MMRQSVIAKQRTSAGFLIPCQFYCSGG----------
A0A287APJ6_BCL2-01      --------------MLLLAAAFLVAFVLLLYMVSPLISPK----------
H3AR18_MCL1-01          --------------------------------------------------
F7G4L5_BCL2L2-04        ---------------------------MPLLILSPYIHASVSSLP-----
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
W5QDH5_BCL2L2-01        --------------MGWPNLKYL-LLGLSPYIHASLLCLT----------
D3Z5F7_BCL2L2-01        --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-05        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-01        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
J7H260_MCL1-01          ------------------------------------MGGS----------
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          --------------------MFN------KKSMVLVCGGAPSMAPNTPAS
R4GAJ0_MCL1-02          ------------------------------------------MAPNTPAS
G1QAV8_MCL1-01          --------------------MFG-PKRNAFIGLNLHCGGAVGGLWRQRSL
A0A2K6F6N9_MCL1-01      ---------------------------DLWINLGISCGRA----------
M3XAP4_MCL1-03          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K6GI15_MCL1-03      --------------------MFG-LKRNAVIGLNLYCGGA----------
C8YZ26_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5CFH3_MCL1-02      --------------------MFG-LQRNAVIGLNLYCGGA----------
F7GTF7_MCL1-03          --------------------MFG-LQRNAVIGLNLYCGGA----------
A0A2K6V5Y3_MCL1-03      --------------------MFG-LQRNAVIGLNLYCGGA----------
A0A2K5LXU8_MCL1-03      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5I9Q7_MCL1-03      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2I2YQH7_MCL1-03      --------------------MFG-LKRNAVIGLNLYCGGA----------
Q07820_MCL1-04          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5W0W9_MCL1-03      --------------------MFG-LKRNAVIGLNLYCGGA----------
F7HUE9_MCL1-02          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K6ECR0_MCL1-03      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5XSC7_MCL1-03      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2R9BYH6_MCL1-03      --------------------MFG-LKRNAVIGLNLYCGGA----------
K7DE58_MCL1-03          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2I3M3D6_MCL1-03      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K6KRW9_MCL1-03      --------------------MFG-FKRNAVIGLNLYCGGA----------
A0A2K6PPL1_MCL1-03      --------------------MFG-FKRNAVIGLNLYCGGA----------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------MFG-LRRNAVIGLNLYCGGA----------
G2HFR3_MCL1-01          --------------MDICRLSAA-MREFYIVHLDIY--------------
A0A1L1RNM6_MCL1-01      --------------------MFA-VKRNAVIGFNLYCGGG----------
A0A1L1RNM6_MCL1-02      --------------------MFA-VKRNAVIGFNLYCGGG----------
F6ZMX1_MCL1-01          --------------------MLGPFKKNAVIGLNLYCGGA----------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-02          --------------------MFG-LRRNAVIGLNLYCG------------
P97287_MCL1-01          --------------------MFG-LRRNAVIGLNLYCGGA----------
G3T756_MCL1-01          --------------------MFG-FKRNAVIGLNLYCGGA----------
G1L3M8_MCL1-02          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2U3V2H3_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
K9IWB2_MCL1-03          --------------------MFG-LQRNAVIGLNLYCGGA----------
K9IWB2_MCL1-02          --------------------MFG-LQRNAVIGLNLYCGGA----------
K9IWB2_MCL1-01          --------------------MFG-LQRNAVIGLNLYCGGA----------
B4DU51_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A287DCH9_MCL1-02      --------------------MFG-LKRNAVIGLNLYCG------------
A0A287DCH9_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A452GAH0_MCL1-02      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5I9Q7_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          --------------------MFG-LQRNAVIGLNLYCGGA----------
A0A2K5EPY9_MCL1-02      --------------------SQS-YNNLKIT-------------------
A0A2K5EPY9_MCL1-01      --------------------NAS-CSRPACF-------------------
J9PBC4_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5C7L5_MCL1-01      --------------------MFG-LQRNALIGLNLYCEWA----------
Q9Z1P3_MCL1-01          --------------------MFG-LRRNAVIGLNLYCGGA----------
A5PJR2_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A452GAH0_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
G1L3M8_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
F7AVA6_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
G1T2Q0_MCL1-02          --------------------MFS-LRRNAVIGLNLYLGGP----------
G1T2Q0_MCL1-01          --------------------MFS-LRRNAVIGLNLYLGGP----------
M3XAP4_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
Q7YRZ9_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
J9PBC4_MCL1-02          --------------------MFG-LKRNAVIGLNLYCGGA----------
Q8HYS5_MCL1-01          --------------------MFG-LKRNAVIRTQLYCGGA----------
M3XZZ5_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A452RHX5_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
H0XFB7_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K6GI15_MCL1-02      --------------------MFG-LKRNAVIGLNLYCGGA----------
F7GTF7_MCL1-02          --------------------MFG-LQRNAVIGLNLYCGGA----------
A0A2K5CFH3_MCL1-01      --------------------MFG-LQRNAVIGLNLYCGGA----------
A0A2K6V5Y3_MCL1-01      --------------------MFG-LQRNAVIGLNLYCGGA----------
A0A2K6KRW9_MCL1-01      --------------------MFG-FKRNAVIGLNLYCGGA----------
A0A2K6PPL1_MCL1-01      --------------------MFG-FKRNAVIGLNLYCGGA----------
A0A2K5XSC7_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A0D9RZP5_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5W0W9_MCL1-02      --------------------MFG-LKRNAVIGLNLYCGGA----------
I7G687_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
F7HUE9_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K6ECR0_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2I3M3D6_MCL1-02      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5LXU8_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2I3GB35_MCL1-02      --------------------MFG-LRRNAVIGLNLYCGGA----------
H2N5Y9_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
Q07820_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2R9BYH6_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
K7DE58_MCL1-01          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2I2YQH7_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5I9Q7_MCL1-02      --------------------MFG-LKRNAVIGLNLYCGGA----------
M3XAP4_MCL1-02          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K6GI15_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
F7GTF7_MCL1-01          --------------------MFG-LQRNAVIGLNLYCGGA----------
A0A2K5CFH3_MCL1-03      --------------------MFG-LQRNAVIGLNLYCGGA----------
A0A2K6V5Y3_MCL1-02      --------------------MFG-LQRNAVIGLNLYCGGA----------
A0A2K6KRW9_MCL1-02      --------------------MFG-FKRNAVIGLNLYCGGA----------
A0A2K6PPL1_MCL1-02      --------------------MFG-FKRNAVIGLNLYCGGA----------
A0A2K5LXU8_MCL1-02      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5W0W9_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K6ECR0_MCL1-02      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2I3M3D6_MCL1-01      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2K5XSC7_MCL1-02      --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2I3GB35_MCL1-01      --------------------MFG-LRRNAVIGLNLYCGGA----------
Q07820_MCL1-03          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2R9BYH6_MCL1-02      --------------------MFG-LKRNAVIGLNLYCGGA----------
K7DE58_MCL1-02          --------------------MFG-LKRNAVIGLNLYCGGA----------
A0A2I2YQH7_MCL1-02      --------------------MFG-LKRNAVIGLNLYCGGA----------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
F6TEC3_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
F6PH48_BCL2L2-01        --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
I3ND50_BCL2L2-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-03        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
F6U940_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-02        --------------------------------------------------
W5QDH5_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
I3ND50_BCL2L2-02        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
Q6GLI5_BCL2L1-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-02        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
A0A2U3V0P1_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-01        --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-02        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
G3RY91_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-03        --------------------------------------------------
Q64373_BCL2L1-04        --------------------------------------------------
P53563_BCL2L1-04        --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4E3I4_MCL1-03      --------------------------------------------------
A0A3B4E3I4_MCL1-02      --------------------------------------------------
A0A3B4E3I4_MCL1-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       --------------------------------------------------
A0A3Q2UUP0_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUP0_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
K7F5Y4_BCL2-02          --------------------------------------------------
K7F5Y4_BCL2-01          --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
H0YUX3_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
J9NXG3_BCL2-02          --------------------------------------------------
G1LID1_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
P10417_BCL2-02          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A287APJ6_BCL2-03      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-02      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
F7BXJ7_BCL2-01          --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
K7F5Y4_BCL2-03          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-02      --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
A0A2K6R2I6_BCL2-02      --------------------------------------------------
J9NXG3_BCL2-01          --------------------------------------------------
A0A1D5QRF2_BCL2-01      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3ULB7_BCL2-01          --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I6_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
P10415_BCL2-01          --------------------------------------------------
P10415_BCL2-02          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2U4BHU7_BCL2-01      --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
G1LID1_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-01      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3ULB7_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
H2MLZ3_MCL1-01          --------------------------------------------------
H2MLZ3_MCL1-02          --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2T2A9_MCL1-02      --------------------------------------------------
A0A3Q2T2A9_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4R7_MCL1-02      --------------------------------------------------
A0A3P9Q4R7_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-02      --------------------------------------------------
A0A3P8VKS9_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-05      --------------------------------------------------
A0A3P8VKS9_MCL1-04      --------------------------------------------------
A0A3P8VKS9_MCL1-03      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3P8NP63_MCL1-03      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0RA11_MCL1-03      --------------------------------------------------
A0A3Q0RA11_MCL1-01      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
G1T1L8_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
E2RS00_BCL2A1-01        --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-02        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-02        --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
C7F841_BCL2A1-02        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A3Q1GS47_BCL2L1-      SDRRTGDSVTERRTASRESRAFVSVLAGPELVC-----------------
A0A2K5DMS4_MCL1-01      ----------------PPGPRLLA--------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          -----G---SSEKTLSARGASPWDPDMDTH-----RPQLNGLGFNNGGS-
F7ETY1_MCL1-01          -----GGGNASEKAVNDRGASPWDADMEAHRDKLDRPQLNGFGFNSGGS-
A0A287APJ6_BCL2-01      -------------PLALPGAHVVVTGGSSGIGKCIA--------------
H3AR18_MCL1-01          --------------------------------------------------
F7G4L5_BCL2L2-04        -----LIAARMATPASAPDTRALVA-------------------------
A0A2K6GWN0_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A2R8M4C0_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A2K5CWZ4_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A2I2YPX6_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A2K6TM77_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
W5QDH5_BCL2L2-01        -----PTAARMATPASAPDTRALVA-------------------------
D3Z5F7_BCL2L2-01        ----------MATPASTPDTRALVA-------------------------
A0A2K6MEE6_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A2K6RW46_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A384DPS8_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A2K5MZX9_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A2K5HEK7_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A2K5V0Q3_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
F7G4L5_BCL2L2-05        ----------MATPASAPDTRALVA-------------------------
A0A2K6EA73_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A2K6AI30_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
G1RYB4_BCL2L2-01        ----------MATPASAPDTRALVA-------------------------
A0A2R9A7B2_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
H2Q805_BCL2L2-02        ----------MATPASAPDTRALVA-------------------------
A0A2I3MUE4_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A287AW74_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
A0A384DPS8_BCL2L2-      ----------MATPASAPDTRALVA-------------------------
J7H260_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          PGAGGGVGESSGGNNNDGGGVSV---------------------------
R4GAJ0_MCL1-02          PGAGGGVGESSGGNNNDGGGVSV---------------------------
G1QAV8_MCL1-01          HLLQEGGPCPQESGAGRETGTVI---------------------------
A0A2K6F6N9_MCL1-01      -----DLGWAWL-GLK----------------------------------
M3XAP4_MCL1-03          -----GLAAGSG-GASSSGGRLV---------------------------
A0A2K6GI15_MCL1-03      -----GLGAGSS-GATPPGGRLL---------------------------
C8YZ26_MCL1-01          -----GLGAGSG-GATRPGGRLL---------------------------
A0A2K5CFH3_MCL1-02      -----GLGAGSG-GATPPGGRLL---------------------------
F7GTF7_MCL1-03          -----GLGAGSG-GATPPGGRLL---------------------------
A0A2K6V5Y3_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
A0A2K5LXU8_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
A0A2K5I9Q7_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
A0A2I2YQH7_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
Q07820_MCL1-04          -----GLGAGSG-GATRPGGRLL---------------------------
A0A2K5W0W9_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
F7HUE9_MCL1-02          -----GLGAGSG-GATPPGGRLL---------------------------
A0A2K6ECR0_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
A0A2K5XSC7_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
A0A2R9BYH6_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
K7DE58_MCL1-03          -----GLGAGSG-GATPPGGRLL---------------------------
A0A2I3M3D6_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
A0A2K6KRW9_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
A0A2K6PPL1_MCL1-03      -----GLGAGSG-GATPPGGRLL---------------------------
K7DE58_MCL1-04          --------SVET--------------------------------------
A0A2I3GB35_MCL1-03      -----GLGAGSG--------------------------------------
G2HFR3_MCL1-01          -------PPPEC--------------------------------------
A0A1L1RNM6_MCL1-01      -----SPGLV---PASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAG-
A0A1L1RNM6_MCL1-02      -----SPGLV---PASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAG-
F6ZMX1_MCL1-01          -----GMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGA
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-02          --------------------------------------------------
P97287_MCL1-01          -----SLGAGGGSPAGAR-----LVAEEAKARREGGGE------------
G3T756_MCL1-01          -----GLG--AGGCATPPGGRLPAPGKEATARQEVGGGD--------AG-
G1L3M8_MCL1-02          -----GLGAGSGGGXS--GGRLLASGKEATARREIGGGEAGAVIGGSAG-
A0A2U3V2H3_MCL1-01      -----GLGPDSGSGASAPGRRLLAAGKEATAGREVGGGEAGEVIGGSAG-
K9IWB2_MCL1-03          -----GLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG-
K9IWB2_MCL1-02          -----GLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG-
K9IWB2_MCL1-01          -----GLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG-
B4DU51_MCL1-01          -----GLG--AGSGG-----------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      -----GLG--ASGGATPPGAQLLAAEKEAAARREAGGGE-----------
A0A452GAH0_MCL1-02      -----GLGQGS--GASSPGGRLLAAGKEATAR---------------AG-
A0A2K5I9Q7_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          -----GLGPGSG-S------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          -----GLGAGSG-GASSSGGRLLASGKEATTRREGGGGEAGAVIGGSAG-
A0A2K5C7L5_MCL1-01      -----GLGTGSG-GTTPPGGRLLATEKEASAQREVGGGEAGVVIGGSAG-
Q9Z1P3_MCL1-01          -----SLGAG---GGSPAGTRLAA--EEAKARRE-GGGEA----------
A5PJR2_MCL1-01          -----GLGQGS--GASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAG-
A0A452GAH0_MCL1-01      -----GLGQGS--GASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAG-
G1L3M8_MCL1-01          -----GLGAGSG-GGXS-GGRLLASGKEATARREIGGGEAGAVIGGSAG-
F7AVA6_MCL1-01          -----GLGAGGG-GASSPGGRLLAAGKEATARREGGGGEAGAVIGGSAG-
G1T2Q0_MCL1-02          -----GLGAGGG-GVAPPAERLLAAEKEAAARLEVGGGEAGAVIGGSPG-
G1T2Q0_MCL1-01          -----GLGAGGG-GVAPPAERLLAAEKEAAARLEVGGGEAGAVIGGSPG-
M3XAP4_MCL1-01          -----GLAAGSG-GASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAG-
Q7YRZ9_MCL1-01          -----GLAAGSG-GASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAG-
J9PBC4_MCL1-02          -----GLGAGSG-GASSSGGRLLASGKEATTRREGGGGEAGAVIGGSAG-
Q8HYS5_MCL1-01          -----GLGAGSG-GASSSGGRLLASGREATTRREGGGGEAGAVIGGSAG-
M3XZZ5_MCL1-01          -----GLGAGTG-GASSSGGRLLASGKEATARREVGGGEAGAVIGGSAG-
A0A452RHX5_MCL1-01      -----GLGAGSG-GAASSGGRLLASGKEATARREVGGGEAGAVIGGSAG-
H0XFB7_MCL1-01          -----GLGAGSG-GATPPGGRLLAAEKEAAARREAGGGEAGEVIGGSPG-
A0A2K6GI15_MCL1-02      -----GLGAGSS-GATPPGGRLLAAEKEATARREVGGGEDGTVIGGSPG-
F7GTF7_MCL1-02          -----GLGAGSG-GATPPGGRLLATEKEASAQREVGGGEAGAVTGGSAG-
A0A2K5CFH3_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASAQREVGGGEAGAVIGGSAG-
A0A2K6V5Y3_MCL1-01      -----GLGAGSG-GATPPGGRLLAAEKEASAQREVGGGEAGAVIGGSAG-
A0A2K6KRW9_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGESAG-
A0A2K6PPL1_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGESAG-
A0A2K5XSC7_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
A0A0D9RZP5_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
A0A2K5W0W9_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
I7G687_MCL1-01          -----GLGAGSS-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
F7HUE9_MCL1-01          -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
A0A2K6ECR0_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
A0A2I3M3D6_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGTAG-
A0A2K5LXU8_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
A0A2I3GB35_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
H2N5Y9_MCL1-01          -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
Q07820_MCL1-01          -----GLGAGSG-GATRPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
A0A2R9BYH6_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
K7DE58_MCL1-01          -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
A0A2I2YQH7_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
A0A2K5I9Q7_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
M3XAP4_MCL1-02          -----GLAAGSG-GASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAG-
A0A2K6GI15_MCL1-01      -----GLGAGSS-GATPPGGRLLAAEKEATARREVGGGEDGTVIGGSPG-
F7GTF7_MCL1-01          -----GLGAGSG-GATPPGGRLLATEKEASAQREVGGGEAGAVTGGSAG-
A0A2K5CFH3_MCL1-03      -----GLGAGSG-GATPPGGRLLATEKEASAQREVGGGEAGAVIGGSAG-
A0A2K6V5Y3_MCL1-02      -----GLGAGSG-GATPPGGRLLAAEKEASAQREVGGGEAGAVIGGSAG-
A0A2K6KRW9_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGESAG-
A0A2K6PPL1_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGESAG-
A0A2K5LXU8_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
A0A2K5W0W9_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
A0A2K6ECR0_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
A0A2I3M3D6_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGTAG-
A0A2K5XSC7_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGTVIGGSAG-
A0A2I3GB35_MCL1-01      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
Q07820_MCL1-03          -----GLGAGSG-GATRPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
A0A2R9BYH6_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
K7DE58_MCL1-02          -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
A0A2I2YQH7_MCL1-02      -----GLGAGSG-GATPPGGRLLATEKEASARREIGGGEAGAVIGGSAG-
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
F6TEC3_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
F6PH48_BCL2L2-01        --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
I3ND50_BCL2L2-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-03        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
F6U940_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-02        --------------------------------------------------
W5QDH5_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
I3ND50_BCL2L2-02        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
Q6GLI5_BCL2L1-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-02        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
A0A2U3V0P1_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-01        --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-02        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
G3RY91_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-03        --------------------------------------------------
Q64373_BCL2L1-04        --------------------------------------------------
P53563_BCL2L1-04        --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4E3I4_MCL1-03      --------------------------------------------------
A0A3B4E3I4_MCL1-02      --------------------------------------------------
A0A3B4E3I4_MCL1-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       --------------------------------------------------
A0A3Q2UUP0_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUP0_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
K7F5Y4_BCL2-02          --------------------------------------------------
K7F5Y4_BCL2-01          --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
H0YUX3_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
J9NXG3_BCL2-02          --------------------------------------------------
G1LID1_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
P10417_BCL2-02          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A287APJ6_BCL2-03      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-02      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
F7BXJ7_BCL2-01          --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
K7F5Y4_BCL2-03          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-02      --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
A0A2K6R2I6_BCL2-02      --------------------------------------------------
J9NXG3_BCL2-01          --------------------------------------------------
A0A1D5QRF2_BCL2-01      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3ULB7_BCL2-01          --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I6_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
P10415_BCL2-01          --------------------------------------------------
P10415_BCL2-02          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2U4BHU7_BCL2-01      --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
G1LID1_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-01      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3ULB7_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
H2MLZ3_MCL1-01          --------------------------------------------------
H2MLZ3_MCL1-02          --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2T2A9_MCL1-02      --------------------------------------------------
A0A3Q2T2A9_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4R7_MCL1-02      --------------------------------------------------
A0A3P9Q4R7_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-02      --------------------------------------------------
A0A3P8VKS9_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-05      --------------------------------------------------
A0A3P8VKS9_MCL1-04      --------------------------------------------------
A0A3P8VKS9_MCL1-03      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3P8NP63_MCL1-03      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0RA11_MCL1-03      --------------------------------------------------
A0A3Q0RA11_MCL1-01      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
G1T1L8_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
E2RS00_BCL2A1-01        --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-02        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-02        --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
C7F841_BCL2A1-02        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------QPCVGLVFTPERPVDISGPWWSEQRAAGRQPGTVCVHSNAAR
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
F7ETY1_MCL1-01          --------------------------------------------------
A0A287APJ6_BCL2-01      ---------------------------------------------IECYK
H3AR18_MCL1-01          --------------------------------------------------
F7G4L5_BCL2L2-04        --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
W5QDH5_BCL2L2-01        --------------------------------------------------
D3Z5F7_BCL2L2-01        --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-05        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-01        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          --------PKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCD
R4GAJ0_MCL1-02          --------PKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCD
G1QAV8_MCL1-01          ---GWSAGASPQATLARDPGRVARPSPMGTEGPDGTAAPARWLFSPISRN
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-03          --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSC7_MCL1-03      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      -------------LWAAAGRAEAPRAPIGSGAAPHAPIGSAAARRAPPDS
A0A1L1RNM6_MCL1-02      -------------LWAAAGRAEAPRAPIGSGAAPHAPIGSAAARRAPPDS
F6ZMX1_MCL1-01          GLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRC
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-02          ----------------------------GAEDPDVTASAERRLHKSPGLL
P97287_MCL1-01          ------------AALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLL
G3T756_MCL1-01          --------ASPPAAVAPDGRRVVRPAPIGAEGPDVTAIPARPTFFAPTRR
G1L3M8_MCL1-02          --------ASPPAXXX--XXXXXXXXXXGAEGPDVTATPPRLLFLEPTRR
A0A2U3V2H3_MCL1-01      --------PSPPATLAPDARRVARPSPIGAEGPDVTATRARLLFFAPTRR
K9IWB2_MCL1-03          --------ASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRL
K9IWB2_MCL1-02          --------ASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRL
K9IWB2_MCL1-01          --------ASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRL
B4DU51_MCL1-01          -----------------------------------ATRPGGRLL------
A0A287DCH9_MCL1-02      ----------------------------GAEVPDVTATPARRLFFAPTYC
A0A287DCH9_MCL1-01      ------------AAQPPSARRVARPVPIGAEVPDVTATPARRLFFAPTYC
A0A452GAH0_MCL1-02      --------PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRL
A0A2K5I9Q7_MCL1-01      --------ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRR
G1PZ39_MCL1-01          ----------------------APPSPISGRGPRRHRDPSRGGCLRPLAV
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          --------ASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCR
A0A2K5C7L5_MCL1-01      --------ASPSAALTPDAR----------------GSCGRCWFFAPTRR
Q9Z1P3_MCL1-01          -------------ALLPGARVVARPPPVGAEDPDVTASAERRLLKSPGLL
A5PJR2_MCL1-01          --------PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRL
A0A452GAH0_MCL1-01      --------PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRL
G1L3M8_MCL1-01          --------ASPPX---------------GAEGPDVTATPPRLLFLEPTRR
F7AVA6_MCL1-01          --------GSPQTTLAPDSLRVARPSPIGAEGPDVTAPSSRLLFFAPTRC
G1T2Q0_MCL1-02          --------ASPPAALAPDARRVARPAPIGAELPDVSATPARLLYLAPTRR
G1T2Q0_MCL1-01          --------A------------------IGAELPDVSATPARLLYLAPTRR
M3XAP4_MCL1-01          --------ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRC
Q7YRZ9_MCL1-01          --------ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRC
J9PBC4_MCL1-02          --------ASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCR
Q8HYS5_MCL1-01          --------ASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCR
M3XZZ5_MCL1-01          --------ASTPATLAPDARRVARPSPIGAEGPNVTATPPRLLFFEPTHR
A0A452RHX5_MCL1-01      --------ASPPATLAPDARRVARPSPIGAEGPDVTATPPRLLFLEPTRR
H0XFB7_MCL1-01          --------ASSPASLTPDARRVARPPPIGAEVPDVTATPTRLLFFAPTLR
A0A2K6GI15_MCL1-02      --------ASPPASLTPEARRVARPAPIGAEVPDVTATPERLLFFAPTRR
F7GTF7_MCL1-02          --------ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRR
A0A2K5CFH3_MCL1-01      --------ASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRR
A0A2K6V5Y3_MCL1-01      --------ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRR
A0A2K6KRW9_MCL1-01      --------ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRR
A0A2K6PPL1_MCL1-01      --------ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRR
A0A2K5XSC7_MCL1-01      --------ASPPAALTPDARRVARPPPIGAEVPDVTATPARLFFFAPTRR
A0A0D9RZP5_MCL1-01      --------ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRR
A0A2K5W0W9_MCL1-02      --------ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRR
I7G687_MCL1-01          --------ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRR
F7HUE9_MCL1-01          --------ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRR
A0A2K6ECR0_MCL1-01      --------ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRR
A0A2I3M3D6_MCL1-02      --------ASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFAPTRR
A0A2K5LXU8_MCL1-01      --------ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRR
A0A2I3GB35_MCL1-02      --------ASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFAPTRR
H2N5Y9_MCL1-01          --------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLFFFAPTRR
Q07820_MCL1-01          --------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRR
A0A2R9BYH6_MCL1-01      --------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRR
K7DE58_MCL1-01          --------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRR
A0A2I2YQH7_MCL1-01      --------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRR
A0A2K5I9Q7_MCL1-02      --------ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRR
M3XAP4_MCL1-02          --------ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRC
A0A2K6GI15_MCL1-01      --------ASPPASLTPEARRVARPAPIGAEVPDVTATPERLLFFAPTRR
F7GTF7_MCL1-01          --------ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRR
A0A2K5CFH3_MCL1-03      --------ASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRR
A0A2K6V5Y3_MCL1-02      --------ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRR
A0A2K6KRW9_MCL1-02      --------ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRR
A0A2K6PPL1_MCL1-02      --------ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRR
A0A2K5LXU8_MCL1-02      --------ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRR
A0A2K5W0W9_MCL1-01      --------ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRR
A0A2K6ECR0_MCL1-02      --------ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRR
A0A2I3M3D6_MCL1-01      --------ASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFAPTRR
A0A2K5XSC7_MCL1-02      --------ASPPAALTPDARRVARPPPIGAEVPDVTATPARLFFFAPTRR
A0A2I3GB35_MCL1-01      --------ASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFAPTRR
Q07820_MCL1-03          --------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRR
A0A2R9BYH6_MCL1-02      --------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRR
K7DE58_MCL1-02          --------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRR
A0A2I2YQH7_MCL1-02      --------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRR
G3WBC5_MCL1-01          ----------------------------------DVTAPPRPFFFAPGGR
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          -------------------------------------MFGLKRNAVIGLN
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
F6TEC3_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
F6PH48_BCL2L2-01        --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
I3ND50_BCL2L2-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-03        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
F6U940_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-02        --------------------------------------------------
W5QDH5_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
I3ND50_BCL2L2-02        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
Q6GLI5_BCL2L1-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-02        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
A0A2U3V0P1_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-01        --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-02        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
G3RY91_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-03        --------------------------------------------------
Q64373_BCL2L1-04        --------------------------------------------------
P53563_BCL2L1-04        --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4E3I4_MCL1-03      --------------------------------------------------
A0A3B4E3I4_MCL1-02      --------------------------------------------------
A0A3B4E3I4_MCL1-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       --------------------------------------------------
A0A3Q2UUP0_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUP0_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
K7F5Y4_BCL2-02          --------------------------------------------------
K7F5Y4_BCL2-01          --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
H0YUX3_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
J9NXG3_BCL2-02          --------------------------------------------------
G1LID1_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
P10417_BCL2-02          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A287APJ6_BCL2-03      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-02      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
F7BXJ7_BCL2-01          --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
K7F5Y4_BCL2-03          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-02      --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
A0A2K6R2I6_BCL2-02      --------------------------------------------------
J9NXG3_BCL2-01          --------------------------------------------------
A0A1D5QRF2_BCL2-01      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3ULB7_BCL2-01          --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I6_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
P10415_BCL2-01          --------------------------------------------------
P10415_BCL2-02          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2U4BHU7_BCL2-01      --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
G1LID1_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-01      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3ULB7_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
H2MLZ3_MCL1-01          --------------------------------------------------
H2MLZ3_MCL1-02          --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2T2A9_MCL1-02      --------------------------------------------------
A0A3Q2T2A9_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4R7_MCL1-02      --------------------------------------------------
A0A3P9Q4R7_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-02      --------------------------------------------------
A0A3P8VKS9_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-05      --------------------------------------------------
A0A3P8VKS9_MCL1-04      --------------------------------------------------
A0A3P8VKS9_MCL1-03      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3P8NP63_MCL1-03      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0RA11_MCL1-03      --------------------------------------------------
A0A3Q0RA11_MCL1-01      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
G1T1L8_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
E2RS00_BCL2A1-01        --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-02        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-02        --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
C7F841_BCL2A1-02        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A3Q1GS47_BCL2L1-      RTRATRTENTLARNMSQNRELVVFYIKYKLS-------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
F7ETY1_MCL1-01          --------------------------------------------------
A0A287APJ6_BCL2-01      QGAFITLVARNEDKLLQAKKEIEKHSINDKQVVLCISVDVSQDYSQVENV
H3AR18_MCL1-01          --------------------------------------------------
F7G4L5_BCL2L2-04        --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
W5QDH5_BCL2L2-01        --------------------------------------------------
D3Z5F7_BCL2L2-01        --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-05        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-01        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
J7H260_MCL1-01          --------LPSPQSELDEDEDYMDVQSDSRG-------------------
H0XHA5_MCL1-01          --LPDQMEAQVADAVKSPEGEVASCEPEPLK-------------------
R4GAJ0_MCL1-01          AEGEGEQPKWRPASLPLPEGELDGCEEAEEE-------------------
R4GAJ0_MCL1-02          AEGEGEQPKWRPASLPLPEGELDGCEEAEEE-------------------
G1QAV8_MCL1-01          C--PEELGALAADAIMSPGEELGRYEPEP---------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-03          --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSC7_MCL1-03      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      TSRPVAL--------WSPEEELDGCEPESE--------------------
A0A1L1RNM6_MCL1-02      TSRPVAL--------WSPEEELDGCEPESE--------------------
F6ZMX1_MCL1-01          SSAPAEVADGAADVPMCPEEELDGYEPEPPG-------------------
A0A286Y1M5_MCL1-01      ---------------MSPEEELDGYEPEPLG-------------------
P97287_MCL1-02          AVPPEEMAASAAAAIVSPEEELDGCEPEAIG-------------------
P97287_MCL1-01          AVPPEEMAASAAAAIVSPEEELDGCEPEAIG-------------------
G3T756_MCL1-01          ASPPVEMEALAADAIMSPEEELDGYEPEPLG-------------------
G1L3M8_MCL1-02          ASPPEEMEGPAADAIMSPEEELDGYEPEPLG-------------------
A0A2U3V2H3_MCL1-01      ASPPEEMESSVSDAIMSPEEELDGCEPEPLG-------------------
K9IWB2_MCL1-03          ASPPEEMESPASDAIMSPEEELDGYEPEPLG-------------------
K9IWB2_MCL1-02          ASPPEEMESPASDAIMSPEEELDGYEPEPLG-------------------
K9IWB2_MCL1-01          ASPPEEMESPASDAIMSPEEELDGYEPEPLG-------------------
B4DU51_MCL1-01          ---ATEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A287DCH9_MCL1-02      VSPPEKMEAPAAA--MSPEEELDGYEPEPLG-------------------
A0A287DCH9_MCL1-01      VSPPEKMEAPAAA--MSPEEELDGYEPEPLG-------------------
A0A452GAH0_MCL1-02      ASPPEEMESPISDAIMSPEEELDGCEPDPLG-------------------
A0A2K5I9Q7_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
G1PZ39_MCL1-01          RGCPRRWKAAAADAIMSPEEELDGYEPEPLG-------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          ASPPEEMEGPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K5C7L5_MCL1-01      AAPLEEMEAPAADAIMSPEEELDRYEPEPLG-------------------
Q9Z1P3_MCL1-01          AVPPEEMAASAA-AIMSPEEELDGCEPEVLS-------------------
A5PJR2_MCL1-01          ASPPEEMESPISDAIMSPEEELDGCEPDPLG-------------------
A0A452GAH0_MCL1-01      ASPPEEMESPISDAIMSPEEELDGCEPDPLG-------------------
G1L3M8_MCL1-01          ASPPEEMEGPAADAIMSPEEELDGYEPEPLG-------------------
F7AVA6_MCL1-01          ASPPEGMEAPAADAIMSPEEELDGYEPEPLG-------------------
G1T2Q0_MCL1-02          ASPLEEMEAPAADAIMSPEEELDGYEPEPLA-------------------
G1T2Q0_MCL1-01          ASPLEEMEAPAADAIMSPEEELDGYEPEPLA-------------------
M3XAP4_MCL1-01          ASPPEKMEGPAADAIMSPEEELDGYEPEPLG-------------------
Q7YRZ9_MCL1-01          ASPPEEMEGPAADAIMSPEEELDGYEPEPLG-------------------
J9PBC4_MCL1-02          ASPPEEMEGPAADAIMSPEEELDGYEPEPLG-------------------
Q8HYS5_MCL1-01          ASPPEEMEGPAADAIMSPEEELDGYEPEPLG-------------------
M3XZZ5_MCL1-01          ASPPEEMEGPAADAIMSPEEELDGYEPEPLG-------------------
A0A452RHX5_MCL1-01      ASPPEEMEGPAADAIMSPEEELDGYEPEPLG-------------------
H0XFB7_MCL1-01          AAPREEMEAPAADAIMSPEDELDGYEPEPLG-------------------
A0A2K6GI15_MCL1-02      ALPSEEMEAPAADAIMSPEDELDGYEPEPLG-------------------
F7GTF7_MCL1-02          AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K5CFH3_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K6V5Y3_MCL1-01      AAPLEEMEAPAADAIMSPEDELDGYEPEPLG-------------------
A0A2K6KRW9_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K6PPL1_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K5XSC7_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A0D9RZP5_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K5W0W9_MCL1-02      AGPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
I7G687_MCL1-01          AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
F7HUE9_MCL1-01          ASPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K6ECR0_MCL1-01      AGPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2I3M3D6_MCL1-02      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K5LXU8_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2I3GB35_MCL1-02      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
H2N5Y9_MCL1-01          AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
Q07820_MCL1-01          AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2R9BYH6_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
K7DE58_MCL1-01          AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2I2YQH7_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K5I9Q7_MCL1-02      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
M3XAP4_MCL1-02          ASPPEKMEGPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K6GI15_MCL1-01      ALPSEEMEAPAADAIMSPEDELDGYEPEPLG-------------------
F7GTF7_MCL1-01          AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K5CFH3_MCL1-03      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K6V5Y3_MCL1-02      AAPLEEMEAPAADAIMSPEDELDGYEPEPLG-------------------
A0A2K6KRW9_MCL1-02      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K6PPL1_MCL1-02      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K5LXU8_MCL1-02      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K5W0W9_MCL1-01      AGPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K6ECR0_MCL1-02      AGPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2I3M3D6_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2K5XSC7_MCL1-02      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2I3GB35_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
Q07820_MCL1-03          AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2R9BYH6_MCL1-02      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
K7DE58_MCL1-02          AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
A0A2I2YQH7_MCL1-02      AAPLEEMEAPAADAIMSPEEELDGYEPEPLG-------------------
G3WBC5_MCL1-01          CSPPAEVADGAADAILSPEDELDGYEPELPG-------------------
W5QI41_MCL1-01          -GSRKPRPAPGPAPALTPPVRCRAQPPEAFAAFPIYGMQIKRQQQWFKMF
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          LYCGGAGLGAGSGGATRPGGRLLATEKEASA-------------------
B4DG83_MCL1-01          ------MEAPAADAIMSPEEELDGYEPEPLG-------------------
B4E3L8_MCL1-01          ------MEAPAADAIMSPEEELDGYEPEPLG-------------------
F8W4Q8_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
F6TEC3_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
F6PH48_BCL2L2-01        --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
I3ND50_BCL2L2-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-03        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
F6U940_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-02        --------------------------------------------------
W5QDH5_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
I3ND50_BCL2L2-02        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
Q6GLI5_BCL2L1-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-02        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
A0A2U3V0P1_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-01        --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-02        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
G3RY91_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-03        --------------------------------------------------
Q64373_BCL2L1-04        --------------------------------------------------
P53563_BCL2L1-04        --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4E3I4_MCL1-03      --------------------------------------------------
A0A3B4E3I4_MCL1-02      --------------------------------------------------
A0A3B4E3I4_MCL1-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       --------------------------------------------------
A0A3Q2UUP0_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUP0_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
K7F5Y4_BCL2-02          --------------------------------------------------
K7F5Y4_BCL2-01          --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
H0YUX3_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
J9NXG3_BCL2-02          --------------------------------------------------
G1LID1_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
P10417_BCL2-02          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A287APJ6_BCL2-03      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-02      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
F7BXJ7_BCL2-01          --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
K7F5Y4_BCL2-03          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-02      --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
A0A2K6R2I6_BCL2-02      --------------------------------------------------
J9NXG3_BCL2-01          --------------------------------------------------
A0A1D5QRF2_BCL2-01      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3ULB7_BCL2-01          --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I6_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
P10415_BCL2-01          --------------------------------------------------
P10415_BCL2-02          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2U4BHU7_BCL2-01      --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
G1LID1_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-01      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3ULB7_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
H2MLZ3_MCL1-01          --------------------------------------------------
H2MLZ3_MCL1-02          --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2T2A9_MCL1-02      --------------------------------------------------
A0A3Q2T2A9_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4R7_MCL1-02      --------------------------------------------------
A0A3P9Q4R7_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-02      --------------------------------------------------
A0A3P8VKS9_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-05      --------------------------------------------------
A0A3P8VKS9_MCL1-04      --------------------------------------------------
A0A3P8VKS9_MCL1-03      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3P8NP63_MCL1-03      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0RA11_MCL1-03      --------------------------------------------------
A0A3Q0RA11_MCL1-01      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
G1T1L8_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
E2RS00_BCL2A1-01        --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-02        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-02        --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
C7F841_BCL2A1-02        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A3Q1GS47_BCL2L1-      ---QRNYPLNHMVLNEAPNRTDGGEARLGEDQRTETHANGTFNGTSPGTP
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          -----------LPCSQEDELDEDMD-----------------NGSQGSTS
F7ETY1_MCL1-01          -----------LTASQEGELDEDID-----------------GGSQGSSS
A0A287APJ6_BCL2-01      IKQAQEKLGPVDMLVNCAGMSLSGK-----------------FEDL----
H3AR18_MCL1-01          -------------------------------------------MELPGDG
F7G4L5_BCL2L2-04        --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
W5QDH5_BCL2L2-01        --------------------------------------------------
D3Z5F7_BCL2L2-01        --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-05        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-01        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
J7H260_MCL1-01          -----------------------------------------------STS
H0XHA5_MCL1-01          ---KQPEGLPLLEFVGEAGNG--PS-----------------TDTLPSTP
R4GAJ0_MCL1-01          ---EAATVPSSTPSPDKEMAEEEGE-----------------KGKGGPPL
R4GAJ0_MCL1-02          ---EAATVPSSTPSPDKEMAEEEGE-----------------KGKGGPPL
G1QAV8_MCL1-01          ---KQPAVLPLLQLVGEA--SEGPA-----------------GGSLPSTP
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-03          --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSC7_MCL1-03      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      --------------------RGPGG-----------------D-SLPGTP
A0A1L1RNM6_MCL1-02      --------------------RGPGG-----------------D-SLPGTP
F6ZMX1_MCL1-01          ---KRPSRLAVLEIARE---GGDSP-----------------NGSLPSTP
A0A286Y1M5_MCL1-01      ---KRPAVLPLLGLVGEAG-KSPSA-----------------DGSLPSTP
P97287_MCL1-02          ---KRPAVLPLLERVSEAA-KSSGA-----------------DGSLPSTP
P97287_MCL1-01          ---KRPAVLPLLERVSEAA-KSSGA-----------------DGSLPSTP
G3T756_MCL1-01          ---KRPAVFPRLGLVGEAS-NGPGT-----------------DGSLPSTP
G1L3M8_MCL1-02          ---KRPAVLPLLELVGEAS-GGPCT-----------------DGSLPSTP
A0A2U3V2H3_MCL1-01      ---KRPSVLPLLELVGEAS-NSPGK-----------------DGSLPSTP
K9IWB2_MCL1-03          ---KRPAVLPLLGLVEEAS-SGPGT-----------------DGSLPSTP
K9IWB2_MCL1-02          ---KRPAVLPLLGLVEEAS-SGPGT-----------------DGSLPSTP
K9IWB2_MCL1-01          ---KRPAVLPLLGLVEEAS-SGPGT-----------------DGSLPSTP
B4DU51_MCL1-01          ---KRPAVLPLLELVGESG-NNTST-----------------DGSLPLTP
A0A287DCH9_MCL1-02      ---KRPAVLPLLELVGEAA-KSPGA-----------------DGSLPSTP
A0A287DCH9_MCL1-01      ---KRPAVLPLLELVGEAA-KSPGA-----------------DGSLPSTP
A0A452GAH0_MCL1-02      ---KRPAVRPLALMVGEASNNSPGS-----------------DGSLPSTP
A0A2K5I9Q7_MCL1-01      ---KRPAVLPLLELVGES--NSSST-----------------DGSLPSTP
G1PZ39_MCL1-01          ---KRPAVLPLVQLVGEASGG-PGA-----------------GGSLPSTP
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          ---KRPAVLPLLELVGEASSG-PGM-----------------DGSLPSTP
A0A2K5C7L5_MCL1-01      ---KRPAVLPLLELVEEPGND-SST-----------------DGSLPSTP
Q9Z1P3_MCL1-01          ---KRPAVLPLLERVSEAAKS-SGA-----------------DGSLPSTP
A5PJR2_MCL1-01          ---KRPAVRPLPLLVGEASNNSPGS-----------------DGSLPSTP
A0A452GAH0_MCL1-01      ---KRPAVRPLALMVGEASNNSPGS-----------------DGSLPSTP
G1L3M8_MCL1-01          ---KRPAVLPLLELVGEASGG-PCT-----------------DGSLPSTP
F7AVA6_MCL1-01          ---KRPAVLPLLEFVREASSG-PCT-----------------DGSLPSTP
G1T2Q0_MCL1-02          ---KRPAVLPLLDLVGEASKV-PST-----------------DGSLPSTP
G1T2Q0_MCL1-01          ---KRPAVLPLLDLVGEASKV-PST-----------------DGSLPSTP
M3XAP4_MCL1-01          ---KRPAVLPLLELVGEASSG-PGT-----------------DGSLPSTP
Q7YRZ9_MCL1-01          ---KRPAVLPLLELVGEASSG-PGT-----------------DGSLPSTP
J9PBC4_MCL1-02          ---KRPAVLPLLELVGEASSG-PGM-----------------DGSLPSTP
Q8HYS5_MCL1-01          ---KRPAVLPLLELVGEASSG-PGM-----------------DGSLPSTP
M3XZZ5_MCL1-01          ---KRPAVLPLLELVGEASSG-PCT-----------------DGSLPSTP
A0A452RHX5_MCL1-01      ---KRPAVLPLLELVGEASGG-PCT-----------------DGSLPSTP
H0XFB7_MCL1-01          ---KRPAVLPLLELVGEASNG-PST-----------------DGSLPSTP
A0A2K6GI15_MCL1-02      ---KRPAVLPLLELVGEASNG-SST-----------------DGSLPSTP
F7GTF7_MCL1-02          ---KRPAVLPLLELVGEPANG-SST-----------------DGSLPSTP
A0A2K5CFH3_MCL1-01      ---KRPAVLPLLELVGEPGNG-SST-----------------DGSLPSTP
A0A2K6V5Y3_MCL1-01      ---KRPAVLPLLELVGEPGHG-SST-----------------DGSLPSTP
A0A2K6KRW9_MCL1-01      ---KRPAVLPLLELVGESGNS-SST-----------------DGSLPSTP
A0A2K6PPL1_MCL1-01      ---KRPAVLPLLELVGESGNS-SST-----------------DGSLPSTP
A0A2K5XSC7_MCL1-01      ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
A0A0D9RZP5_MCL1-01      ---KRPAVLPLLELVGESGNS-SST-----------------DGSLPSTP
A0A2K5W0W9_MCL1-02      ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
I7G687_MCL1-01          ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
F7HUE9_MCL1-01          ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
A0A2K6ECR0_MCL1-01      ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
A0A2I3M3D6_MCL1-02      ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
A0A2K5LXU8_MCL1-01      ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
A0A2I3GB35_MCL1-02      ---KRPAVLPLLELVGESGNN-TST-----------------DGSLPSTP
H2N5Y9_MCL1-01          ---KRPAVLPLLELVGESGNN-TST-----------------DGSLPSTP
Q07820_MCL1-01          ---KRPAVLPLLELVGESGNN-TST-----------------DGSLPSTP
A0A2R9BYH6_MCL1-01      ---KRPAVLPLLELVGESGNN-TST-----------------DGSLPSTP
K7DE58_MCL1-01          ---KRPAVLPLLELVGESGNN-TST-----------------DGSLPSTP
A0A2I2YQH7_MCL1-01      ---KRPAVLPLLELVGESGND-TST-----------------DGSLPSTP
A0A2K5I9Q7_MCL1-02      ---KRPAVLPLLELVGES-NS-SST-----------------DGSLPSTP
M3XAP4_MCL1-02          ---KRPAVLPLLELVGEASSG-PGT-----------------DGSLPSTP
A0A2K6GI15_MCL1-01      ---KRPAVLPLLELVGEASNG-SST-----------------DGSLPSTP
F7GTF7_MCL1-01          ---KRPAVLPLLELVGEPANG-SST-----------------DGSLPSTP
A0A2K5CFH3_MCL1-03      ---KRPAVLPLLELVGEPGNG-SST-----------------DGSLPSTP
A0A2K6V5Y3_MCL1-02      ---KRPAVLPLLELVGEPGHG-SST-----------------DGSLPSTP
A0A2K6KRW9_MCL1-02      ---KRPAVLPLLELVGESGNS-SST-----------------DGSLPSTP
A0A2K6PPL1_MCL1-02      ---KRPAVLPLLELVGESGNS-SST-----------------DGSLPSTP
A0A2K5LXU8_MCL1-02      ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
A0A2K5W0W9_MCL1-01      ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
A0A2K6ECR0_MCL1-02      ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
A0A2I3M3D6_MCL1-01      ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
A0A2K5XSC7_MCL1-02      ---KRPAVLPLLELVGESGNS-PST-----------------DGSLPSTP
A0A2I3GB35_MCL1-01      ---KRPAVLPLLELVGESGNN-TST-----------------DGSLPSTP
Q07820_MCL1-03          ---KRPAVLPLLELVGESGNN-TST-----------------DGSLPSTP
A0A2R9BYH6_MCL1-02      ---KRPAVLPLLELVGESGNN-TST-----------------DGSLPSTP
K7DE58_MCL1-02          ---KRPAVLPLLELVGESGNN-TST-----------------DGSLPSTP
A0A2I2YQH7_MCL1-02      ---KRPAVLPLLELVGESGND-TST-----------------DGSLPSTP
G3WBC5_MCL1-01          ---KRPARLAMLPLAREGGDTSSNA-----------------RGSLPSTP
W5QI41_MCL1-01          GFKRRPAVRPLPLMVGEASNNSPGS-----------------DGSLPSTP
F1MQX4_MCL1-01          ----------------------------------------------GMLP
B4DLY8_MCL1-01          ---RRE--------IGGGEAGAV-I-----------------GGSAGASP
B4DG83_MCL1-01          ---KRPAVLPLLELVGESGNNTS-T-----------------DGSLPSTP
B4E3L8_MCL1-01          ---KRPAVLPLLELVGESGNNTS-T-----------------DGSLPSTP
F8W4Q8_MCL1-02          ---MIL--------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
F6TEC3_BCL2L2-01        -------------------RKKGNNGVKDRDWEEQHATGNIIFRGSPDKY
G1Q051_BCL2L2-01        ----------------------------MNEFSLDNFMLYSFDSVDIRPK
G3WPT2_BCL2L2-01        --------------------------------------HSSSPIFFSLPF
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
F6PH48_BCL2L2-01        --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
I3ND50_BCL2L2-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-03        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
F6U940_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-02        --------------------------------------------------
W5QDH5_BCL2L2-02        ------------------------MGWPNLKYLLLGLSPYIHASLLCLTP
Q7TS60_BCL2L2-01        ----------------------------MSLFGLCQYFSYIYVSLSSLPL
G1LMC3_BCL2L2-01        --------------------------------------PYIHASLSSLTL
M3Y5X5_BCL2L2-01        ----------------------------KPEAPLLAFQPYIHASLSSLTL
G1P3J2_BCL2L2-01        ----------------------------PEMLHSVSLTKYTHASLLSLTF
I3ND50_BCL2L2-02        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
Q6GLI5_BCL2L1-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-02        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
A0A2U3V0P1_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-01        --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-02        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
G3RY91_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-03        --------------------------------------------------
Q64373_BCL2L1-04        --------------------------------------------------
P53563_BCL2L1-04        --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4E3I4_MCL1-03      --------------------------------------------------
A0A3B4E3I4_MCL1-02      --------------------------------------------------
A0A3B4E3I4_MCL1-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------MGHILLSATAGS
Q564A4_BCL2-01          --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       ---------------------------------------------MSRGG
A0A3Q2UUP0_BCL2L10      ---MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGG
A0A3P8PVZ8_BCL2L10      ---MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGG
A0A3Q2UUP0_BCL2L10      ---MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGG
A0A3P9BLI0_BCL2L10      ---MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGG
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      ----------------------------------MYLTACVCTLHWREKH
H9GPE7_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
K7F5Y4_BCL2-02          --------------------------------------------------
K7F5Y4_BCL2-01          --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
H0YUX3_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
J9NXG3_BCL2-02          --------------------------------------------------
G1LID1_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
P10417_BCL2-02          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A287APJ6_BCL2-03      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        ---------------------------------------------RSHPG
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
A0A3B3C5I4_BCL2L10      -------------------------------------------------M
A0A3Q2Y539_MCL1-01      ----------------------------------------MPESKRFPLY
H3AR18_MCL1-02          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-02      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
A0A3P8WUE9_BCL2-01      -------------------------------------------------M
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
Q8UWD6_MCL1-01          ---------------------------------------------MFAGR
F8W4Q8_MCL1-01          ---------------------------------------------MFAGR
Q568W5_MCL1-01          ---------------------------------------------MFAGR
M3Y8D1_BCL2L10-01       --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
F7G6M3_BCL2L2-01        ---MPSARNSPLPRQSAAPQPCCLAPCPSRPPGSPPDAPPRPPPPRCPAA
G1TV33_BCL2L2-01        ---LSLCLHIPDIHAGLSSLPLT--------------------------A
A0A2K5CWZ4_BCL2L2-      ---MPLLVLCPYIHASLSSLPLI--------------------------A
A0A2R8M4C0_BCL2L2-      -----LLVLCPYINASLSSLPLI--------------------------A
G3TMU7_BCL2L2-01        -----------YIHVSLSSLTLA--------------------------A
A0A2K5CWZ4_BCL2L2-      ---------------HLSSLPLI--------------------------A
A0A2K6TM77_BCL2L2-      ---------------HLSSLPLI--------------------------A
A0A3P8W7K5_BCL2L10      ------------------------------------------------MC
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
F7BXJ7_BCL2-01          --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
K7F5Y4_BCL2-03          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-02      --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
A0A2K6R2I6_BCL2-02      --------------------------------------------------
J9NXG3_BCL2-01          --------------------------------------------------
A0A1D5QRF2_BCL2-01      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3ULB7_BCL2-01          --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I6_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
P10415_BCL2-01          --------------------------------------------------
P10415_BCL2-02          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2U4BHU7_BCL2-01      --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
G1LID1_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-01      --------------------------------------------------
G3WZW9_BCL2-02          -------------------------------------PFGCSPWCSLLSP
G3ULB7_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
H2MLZ3_MCL1-01          --------------------------------------------------
H2MLZ3_MCL1-02          --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-01      --------------------------------------------------
A0A3Q3B4V7_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2T2A9_MCL1-02      --------------------------------------------------
A0A3Q2T2A9_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4R7_MCL1-02      --------------------------------------------------
A0A3P9Q4R7_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-02      --------------------------------------------------
A0A3P8VKS9_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-05      --------------------------------------------------
A0A3P8VKS9_MCL1-04      --------------------------------------------------
A0A3P8VKS9_MCL1-03      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3P8NP63_MCL1-03      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0RA11_MCL1-03      --------------------------------------------------
A0A3Q0RA11_MCL1-01      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
G1T1L8_BCL2A1-01        -------------------------------MFASQGFGSFQKKQSPALL
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
E2RS00_BCL2A1-01        --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-02        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-02        --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
C7F841_BCL2A1-02        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       -------------------------------------------------M
F1RZB9_BCL2L10-01       --------------------------------------------------
G1T264_BCL2L10-01       ------------------------------------------------RP
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       ----------------------------------------------GRPP
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       ---------------------------------------------MVDQL
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      ---------------------------------------------MADQL
A0A2K6M5H5_BCL2L10      ---------------------------------------------MADPL
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       ---------------------------------------------MVDQL
G3QLU6_BCL2L10-01       ---------------------------------------------MVDQW
A0A2R9BCD9_BCL2L10      ---------------------------------------------MVDQW
H2Q9G4_BCL2L10-01       ---------------------------------------------MVDQW
Q9HD36_BCL2L10-01       ---------------------------------------------MVDQL
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q0RA11_MCL1-02      ---------MPERNGSAISTQLGLHPRIS---------------------
I3KXG5_MCL1-01          ---------LERETKLIIHSFLGDFTGLSQPQRKET--------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F6VJQ0_BCL2L10-01       -------MDYKCALREETARLVTDYLEYCCRREGVQ--------------
A0A3Q1GS47_BCL2L1-      PPSP----------------------RRLASTATMD--------------
A0A2K5DMS4_MCL1-01      --------------------------------TGAK-------------D
A0A3P8V8T6_MCL1-01      --------LTLCTLENDTRQLICDFLKDFTTKSTQR-------------L
B6V6J0_MCL1-01          PPDSPV--CPKDGLYMDTQQLILAFYRVYS-------------------G
F7ETY1_MCL1-01          PPDSPV--CPKDGLYMDTQQLILAFFRGYC-------------------G
A0A287APJ6_BCL2-01      --------EVSTFERLMSVNYLGSVYPSRAVITTMKERRVGRIVFVSSQA
H3AR18_MCL1-01          CPQD----GDMAEFRKETLKLLRSYLCEVA---GCE-------------S
F7G4L5_BCL2L2-04        -------------------DFVGYKLRQKGYVCGAG--------------
A0A2K6GWN0_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
A0A2R8M4C0_BCL2L2-      -------------------DFVGYKLRQKGYVCGTG--------------
A0A2K5CWZ4_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
A0A2I2YPX6_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
A0A2K6TM77_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
W5QDH5_BCL2L2-01        -------------------DFVGYKLRQKGYVCGAG--------------
D3Z5F7_BCL2L2-01        -------------------DFVGYKLRQKGYVCGAG--------------
A0A2K6MEE6_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
A0A2K6RW46_BCL2L2-      -------------------DFLGYKLRQKGYVCGAG--------------
A0A384DPS8_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
A0A2K5MZX9_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
A0A2K5HEK7_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
A0A2K5V0Q3_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
F7G4L5_BCL2L2-05        -------------------DFVGYKLRQKGYVCGAG--------------
A0A2K6EA73_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
A0A2K6AI30_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
G1RYB4_BCL2L2-01        -------------------DFVGYKLRQKGYVCGAG--------------
A0A2R9A7B2_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
H2Q805_BCL2L2-02        -------------------DFVGYKLRQKGYVCGAG--------------
A0A2I3MUE4_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
A0A287AW74_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
A0A384DPS8_BCL2L2-      -------------------DFVGYKLRQKGYVCGAG--------------
J7H260_MCL1-01          PPLTPT--CSPDPLHTETRALLHTFFREWA--GDAK----------QEDG
H0XHA5_MCL1-01          PPA-----EEEDELYWQSMEIISRYLWEQE--TGED--------------
R4GAJ0_MCL1-01          FP---------DHLRKTTLEVVGRYLREAADEAGSK-------------G
R4GAJ0_MCL1-02          FP---------DHLRKTTLEVVGRYLREAADEAGSK-------------G
G1QAV8_MCL1-01          PPAEEEE-ELS------LLEMIPQHLRERA--GARD--------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          -----------------------------A--TGAK-------------D
A0A2K6GI15_MCL1-03      -----------------------------A--TGAK-------------D
C8YZ26_MCL1-01          -----------------------------A--TGAK-------------D
A0A2K5CFH3_MCL1-02      -----------------------------A--TGAK-------------D
F7GTF7_MCL1-03          -----------------------------A--TGAK-------------D
A0A2K6V5Y3_MCL1-03      -----------------------------A--TGAK-------------D
A0A2K5LXU8_MCL1-03      -----------------------------A--TGAK-------------D
A0A2K5I9Q7_MCL1-03      -----------------------------A--TGAK-------------D
A0A2I2YQH7_MCL1-03      -----------------------------A--TGAK-------------D
Q07820_MCL1-04          -----------------------------A--TGAK-------------D
A0A2K5W0W9_MCL1-03      -----------------------------A--TGAK-------------D
F7HUE9_MCL1-02          -----------------------------A--TGAK-------------D
A0A2K6ECR0_MCL1-03      -----------------------------A--TGAK-------------D
A0A2K5XSC7_MCL1-03      -----------------------------A--TGAK-------------D
A0A2R9BYH6_MCL1-03      -----------------------------A--TGAK-------------D
K7DE58_MCL1-03          -----------------------------A--TGAK-------------D
A0A2I3M3D6_MCL1-03      -----------------------------A--TGAK-------------D
A0A2K6KRW9_MCL1-03      -----------------------------A--TGAK-------------D
A0A2K6PPL1_MCL1-03      -----------------------------A--TGAK-------------D
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      PELPDLI-PDE--LRQESLELILRYLREAA--GEAEPGVKKLFPGLLGGP
A0A1L1RNM6_MCL1-02      PELPDLI-PDE--LRQESLELILRYLREAA--GEAEPGVKKLFPGLLGGP
F6ZMX1_MCL1-01          PP-AEED-EEEDELYGQSLELISRYLREQA--VGTK-------------E
A0A286Y1M5_MCL1-01      PP-AEEE-EEEDALYRQSLEIISRYLREQA--AGAK-------------D
P97287_MCL1-02          PP-PEEE-EDD--LYRQSLEIISRYLREQA--TGSK-------------D
P97287_MCL1-01          PP-PEEE-EDD--LYRQSLEIISRYLREQA--TGSK-------------D
G3T756_MCL1-01          PL-AEEE-EDE--LYRQSLEIISRYLQEQA--TGAK-------------D
G1L3M8_MCL1-02          PP-AEEE-EDE--LYRQSLEIISRYLREQA--TGAK-------------D
A0A2U3V2H3_MCL1-01      PP-AEEE-EDE--LYRQSLEIISRYLREQA--TGTK-------------D
K9IWB2_MCL1-03          PP-AEEE-EDE--LYRQSLEIISRYLREQA--TGAK-------------D
K9IWB2_MCL1-02          PP-AEEE-EDE--LYRQSLEIISRYLREQA--TGAK-------------D
K9IWB2_MCL1-01          PP-AEEE-EDE--LYRQSLEIISRYLREQA--TGAK-------------D
B4DU51_MCL1-01          PP-AEEE-EDE--LYRQSLEIISRYLREQA--TGAK-------------D
A0A287DCH9_MCL1-02      PP-AEEE-DDE--LYRQSLEIISRYLREQA--TGSK-------------D
A0A287DCH9_MCL1-01      PP-AEEE-DDE--LYRQSLEIISRYLREQA--TGSK-------------D
A0A452GAH0_MCL1-02      PP-SEEE-EDE--LYRQSLEIISQYLLEQA--TGAK-------------D
A0A2K5I9Q7_MCL1-01      PP-AEEE-EDE--LYRQSLEIISRYLREQA--TGAK-------------D
G1PZ39_MCL1-01          PPAE----EEEDELFRQSLEIISRY-REQA--TGAK-------------D
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K5C7L5_MCL1-01      P---------------TSLEIISRYLREQA--TGAK-------------D
Q9Z1P3_MCL1-01          PPPE----EEDDELYHQSLEIISRYLREQA--TGSK-------------D
A5PJR2_MCL1-01          PPAE----EEEDELYRQSLEIISQYLREQA--TGAK-------------D
A0A452GAH0_MCL1-01      PPSE----EEEDELYRQSLEIISQYLLEQA--TGAK-------------D
G1L3M8_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
F7AVA6_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGTK-------------D
G1T2Q0_MCL1-02          PPAE----EEEDELYRQSLEIIARYLREQA--TGAK-------------D
G1T2Q0_MCL1-01          PPAE----EEEDELYRQSLEIIARYLREQA--TGAK-------------D
M3XAP4_MCL1-01          PPAE----EEEDELFRQSLEIISRYLREQA--TGAK-------------D
Q7YRZ9_MCL1-01          PPAE----EEEDELFRQSLEIISRYLREQA--TGAK-------------D
J9PBC4_MCL1-02          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
Q8HYS5_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
M3XZZ5_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A452RHX5_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
H0XFB7_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K6GI15_MCL1-02      PPAE----EEDDELYRQSLEIISRYLREQA--TGAK-------------D
F7GTF7_MCL1-02          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K5CFH3_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K6V5Y3_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K6KRW9_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K6PPL1_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K5XSC7_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A0D9RZP5_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K5W0W9_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
I7G687_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
F7HUE9_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K6ECR0_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2I3M3D6_MCL1-02      PPAE----EEEDELYRQSLEIISWYLREQA--TGAK-------------D
A0A2K5LXU8_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2I3GB35_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
H2N5Y9_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
Q07820_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2R9BYH6_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
K7DE58_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2I2YQH7_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K5I9Q7_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
M3XAP4_MCL1-02          PPAE----EEEDELFRQSLEIISRYLREQA--TGAK-------------D
A0A2K6GI15_MCL1-01      PPAE----EEDDELYRQSLEIISRYLREQA--TGAK-------------D
F7GTF7_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K5CFH3_MCL1-03      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K6V5Y3_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K6KRW9_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K6PPL1_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K5LXU8_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K5W0W9_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2K6ECR0_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2I3M3D6_MCL1-01      PPAE----EEEDELYRQSLEIISWYLREQA--TGAK-------------D
A0A2K5XSC7_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2I3GB35_MCL1-01      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
Q07820_MCL1-03          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2R9BYH6_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
K7DE58_MCL1-02          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
A0A2I2YQH7_MCL1-02      PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
G3WBC5_MCL1-01          PPAEEDEDEEEDELYGQSLELITRYLREQA--VGTK-------------D
W5QI41_MCL1-01          PPSE----EEEDELYRQSLEIISQYLLEQA--TGTK-------------D
F1MQX4_MCL1-01          IFSE----EEEDELYWQSLEIISRYLREQA--TGAK-------------D
B4DLY8_MCL1-01          PSTL----TPDSR-------------RVAR--PPPK-------------D
B4DG83_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
B4E3L8_MCL1-01          PPAE----EEEDELYRQSLEIISRYLREQA--TGAK-------------D
F8W4Q8_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       -------DELKLRTRRLLTEFLEHRTRRRGTAPQ----------------
H3AAS7_BCL2L2-02        -------MDSLYSNRGVVEDFIYYKLGQKGYSQQG---------------
H3AAS7_BCL2L2-01        -------MDSLYSNRGVVEDFIYYKLGQKGYSQQG---------------
F6TEC3_BCL2L2-01        LTEQGWMAQSELGSRALVEDFVRYKLCQRSLVPEP---------------
G1Q051_BCL2L2-01        VLGPKSSQPQAPDTQALVADFVGYKLRQKGYVCGA---------------
G3WPT2_BCL2L2-01        IASQMATPASAPDTRALVADFVGYKLRQKGYACGT---------------
P70345_BCL2L2-01        ----MATPASTPDTRALVADFVGYKLRQKGYVCGA---------------
O88996_BCL2L2-01        ----MATPASTPDTRALVADFVGYKLRQKGYVCGA---------------
A0A3Q9B4M8_BCL2L2-      ----MATPASAPDTRALVADFVGYKMRQKGYVCGA---------------
H0XR82_BCL2L2-01        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
Q92843_BCL2L2-02        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
Q05KI8_BCL2L2-01        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
Q1RMX3_BCL2L2-01        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
Q45T69_BCL2L2-01        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A452ECF0_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A286XQQ9_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2K5MZX9_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A0D9RU30_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2K5HEK7_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
F6PH48_BCL2L2-01        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2I2UAE3_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2I2YPX6_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
I3ND50_BCL2L2-01        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2K5V0Q3_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
F7G4L5_BCL2L2-02        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
F7G4L5_BCL2L2-03        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2K6EA73_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2K6AI30_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
G1RYB4_BCL2L2-03        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2R9A7B2_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
H2Q805_BCL2L2-01        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2I3MUE4_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2K6GWN0_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2K6MEE6_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2K6RW46_BCL2L2-      ----MATPASAPDTRALVADFLGYKLRQKGYVCGA---------------
A0A2K6RW46_BCL2L2-      ----MATPASAPDTRALVADFLGYKLRQKGYVCGA---------------
A0A2K6TM77_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A287AW74_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A2U4CFE3_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A452SHI1_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
A0A384DPS8_BCL2L2-      ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
F6U940_BCL2L2-01        ----MATPASAPDTRALVADFVGYKLRQKGYACGT---------------
G3WPT2_BCL2L2-02        ----MATPASAPDTRALVADFVGYKLRQKGYACGT---------------
W5QDH5_BCL2L2-02        TAARMATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
Q7TS60_BCL2L2-01        SAARMATPASTPDTRALVADFVGYKLRQKGYVCGA---------------
G1LMC3_BCL2L2-01        TAARMATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
M3Y5X5_BCL2L2-01        TAARMATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
G1P3J2_BCL2L2-01        TAARMATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
I3ND50_BCL2L2-02        ----MATPASAPDTRALVADFVGYKLRQKGYVCGA---------------
P70345_BCL2L2-04        ----MATPASTPDTRALVADFVGYKLRQKGYVCGA---------------
Q6GLI5_BCL2L1-01        ---------MEGSSRDLVEKFVCKKLSQKGAC-GEFSSNSQPKGVSNGSS
Q2TAP5_BCL2L1-01        ---------MEGSSRDLVEKFVSKKLSQNEAC-RKFSNNPQPNAISNGTS
Q91828_BCL2L1-01        ---------MEGSSRDLVEKFVSKKLSQNEAC-RKFSNNPNPMPYLMEPS
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFS-------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        ---------MSSSNRALVVDFLSYKLSQRGHSWHEIE-----MESGEEAM
Q07816_BCL2L1-04        ---------MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTD----T
Q07817_BCL2L1-02        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2K5YR37_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A452E1B1_BCL2L1-      ---------MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGT
W5PSA5_BCL2L1-01        ---------MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGT
Q07816_BCL2L1-01        ---------MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAA--
Q07816_BCL2L1-03        ---------MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAA--
Q07816_BCL2L1-02        ---------MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAA--
G1N5N5_BCL2L1-01        ---------MSSSNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAA--
A0A452ILL8_BCL2L1-      ---------MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTDSAE--
A0A452ILL8_BCL2L1-      ---------MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTDSAE--
K7F655_BCL2L1-01        ---------MSNTNRELVIDFLSYKLSQRGHSWSWFEGEDEIRTEAAE--
A0A287CZ07_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
F6WA14_BCL2L1-01        ---------MSHSNRELVIDFLSYKLSQKGYNWSQFED--ENRTEVLEGA
G3WKX6_BCL2L1-01        ---------MSHSNRELVVDFLSYKLSQKGYNWSQFED--ENRTEASEGT
F6WQI0_BCL2L1-02        ---------MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGT
G3SPN0_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTGASEGT
H0X6V2_BCL2L1-01        ---------MSQSNRELVVDFISYKLSQKGYSWSQFSDVEENRTEAPEGN
Q2PFS6_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
P53563_BCL2L1-03        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
O35843_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
G1RER8_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
Q64373_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
Q64373_BCL2L1-09        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
P53563_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
A0A2U3V0P1_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGT
O77737_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGT
Q9MYW4_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
F6WQI0_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGT
B2Z3Z4_BCL2L1-01        ---------MSQSNRELVVDFLSYKFSQKGYSWSQFSDVEENRTEAPEGT
Q05KJ0_BCL2L1-02        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
Q05KJ0_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
E2IV76_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEGT
A0A2K6G3C5_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEAT
M3Z2H9_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGT
A0A0D9RJZ8_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A286Y5D6_BCL2L1-      ---------MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGT
A0A1L5BWY3_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGI
I3MUP5_BCL2L1-03        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
I3MUP5_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
I3MUP5_BCL2L1-02        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
G1P9D2_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2K5EBP4_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
E2IV75_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
F7IT34_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
F7IT34_BCL2L1-02        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
Q76LT7_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2K5M8B1_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2K5H963_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
M3XA94_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
Q8SQ42_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGT
G3RY91_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
Q07817_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
Q07817_BCL2L1-03        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2K5VPG2_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
F6UKR4_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2K5YR37_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2J8VIH3_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2K6LPM4_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2K6QFA2_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2K6QFA2_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A2K6UWY8_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
E2IV77_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A452SDS4_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A384D3U1_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
A0A452FWV3_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
Q9MZS7_BCL2L1-01        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGT
Q64373_BCL2L1-03        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
Q64373_BCL2L1-04        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
P53563_BCL2L1-04        ---------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
A0A3B1IEV7_MCL1-01      ---MNPTAISLLCDGTSPVLYRTEKEEKLPRTERPERGLEG-------LQ
A0A3B4E3I4_MCL1-03      ---MESAAISLFCNGAGRIPFNKGSESQLDRPDRPDRGLEG-------LQ
A0A3B4E3I4_MCL1-02      ---ME-------AHGGVQINMAAHPGGSICAPVLHGSSFGGPVTLIYLIH
A0A3B4E3I4_MCL1-01      ---ME-------AHGGVQINMAAHPGGSICAPVLHGSSFGGPVTLIYLIH
A0A3Q3B0R2_BCL2-01      ----------MEVNRFIVENYICHKLSKRGYAWGSDRPRRVRDDAANNGS
A0A3Q2PN77_BCL2-01      --------MANDCNRDIVENYIFHKLSKRGYAWRFDGVR--DDDAAANGG
A0A1X9JZA1_BCL2-01      --------MANECNRNIVEKYICHKLSKQGYEWGFDAVR--NADAGNNGS
A0A3Q0S5Z7_BCL2-01      --------MANEYNRNIVEKYICHKLSKRGYAWGFDGVQ--DEDAANNGS
A0A3P8QVM8_BCL2-01      --------MENEYNRNIVEKYICHKLSKRGFVWGFRVVQ--EEDAANNGS
A0A3P9DIG5_BCL2-01      --------MENEYNRNIVEKYICHKLSKRGFVWGFRVVQ--EEDAANNGS
A0A3Q2UYW8_BCL2-01      --------MANEYNRNIVEKYICHKLSKRGFVWGFRVVQ--EEDAANNGS
A0A3B4G3K4_BCL2-01      --------MANEYNRNIVEKYICHKLSKRGFVWGFRVVQ--EEDAANNGS
A0A3Q1I5N1_BCL2-01      --------MANECNRNIVEKYICHKLSKRGYAWGFHDAQ--DEDAANNGS
A0A3Q3K1K1_BCL2-01      --------MANECNRNVVEKYICHKLSKRGYVWGFHDVQ--DEDAANNGS
A0A3Q3MEY1_BCL2-01      --------MANECNRNIVEKYICHKLSKRGYVWGFHNVQ--DEDAANNGS
A0A3Q1FLK7_BCL2-01      --------MANECNRNIVEKYICHKLSKRGYVWGFDDVR--DEDAANNGS
A0A3Q1B8C3_BCL2-01      --------MANECNRNIVEKYICHKLSKRGYVWGFDDVR--DEDAANNGS
A0A3P8S9L3_BCL2-01      --------MANECNRNIVEKYICHKLSKRGYVWGFDDVR--DEDAANNGS
A0A3B5BBQ0_BCL2-01      --------MANECNRNIVEKYICHKLSKRGYAWGFDDVR--DEDAANNGS
A0A3B4TX71_BCL2-01      --------MASEYNRNIVEKYICHKLSKQGYVWGFDDVR--DEDAANNGS
A0A3B4YAG2_BCL2-01      --------MASEYNRNIVEKYICHKLSKRGYVWGFDDVR--DEDAANNGS
A0A286XUI2_BCL2A1-      LDLREPAAGCCLPPRMIDLEFRYTQALAQDYLLHV------------LQV
Q564A4_BCL2-01          -----MANEISYDNRNIVEKYLKHKLSKRGYVWKC---------------
W5N4F7_BCL2-01          ----MANNEAPYDTRNIVTKYIHHKLLKKGYVWES---------------
A0A3Q4MN81_BCL2L10      ----------------------MCREQSDIAGRKMKFCG------LWKET
A0A3B4ETX9_BCL2L10      ----------------------MCREQSDIAGRKMKFCG------LWKET
D2IT42_BCL2L10-02       -----------------------------------MSCR------LWKET
A0A3Q0S9R1_BCL2L10      -----------------------------------MVPG------LWKET
I3J363_BCL2L10-01       VTHSLSAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCG------LWKET
A0A3Q2UUP0_BCL2L10      VTHSASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCG------LWKET
A0A3P8PVZ8_BCL2L10      VTHSASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCG------LWKET
A0A3Q2UUP0_BCL2L10      VTHSASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCG------LWKET
A0A3P9BLI0_BCL2L10      VTHSASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCG------LWKET
A0A3Q2PJS5_BCL2L10      ----------------------MCREPSHIAGRKMS-CG------LWKET
A0A3Q2GL87_BCL2L10      ----------------------MCREPLHITGRKMS-CG------LWKET
A0A3B5MJ12_BCL2L10      ----------------------------------MS-CG------LWKET
M4AUW7_BCL2L10-01       ----------------------------------MS-CG------LWKET
A0A096ME02_BCL2L10      ------------MHRGSPSAVWMCREPSHIAGRKMS-CG------LWKET
A0A3B3TYN4_BCL2L10      ------------MHRGSPSAVWMCREPSHIAGRKMS-CG------LWKET
A0A3B3YT99_BCL2L10      ------------MHRGSPSAVWMCREPSHIAGRKMS-CG------LWKET
A0A3P9NE65_BCL2L10      ------------MRRGSPSAVWMCREPSHIAGRKMS-CG------LWKET
A0A3P9LM07_BCL2L10      ----------------------------------MS-CG------LRKET
H2MBQ3_BCL2L10-01       ----------------------------------MS-CG------LRKET
A0A3B4AAV4_BCL2L10      ----------------------------------MS-CG------LWKET
A0A3Q3EZU5_BCL2L10      ----------------------MCRAQSDIAGRKMS-CG------LWKET
A0A3Q3EZU5_BCL2L10      ----------------------MCRAQSDIAGRKMS-CG------LWKET
A0A3Q3JQ78_BCL2L10      ----------------------MCREHLDIAGRKMS-CG------LWKDT
A0A3B4TIY6_BCL2L10      ----------------------------------MS-CG------LWKET
A0A3B4WGF4_BCL2L10      ----------------------------------MS-CG------LWKET
A0A3Q3KZW1_BCL2L10      ----------------------------------MS-CG------LWKET
A0A3B5KD08_BCL2L10      ----------------------------------MS-CG------LWKET
A0A3Q3VI28_BCL2L10      ----------------------------------MS-CG------LWKET
A0A3Q1GM98_BCL2L10      ----------------------------------MS-CG------LWKET
A0A3Q1D2L0_BCL2L10      ----------------------------------MS-CG------LWKET
A0A3P8RL82_BCL2L10      ----------------------------------MS-CG------LWKET
A0A3B4ZFS0_BCL2L10      ----------------------------------MS-CG------LWKET
A0A3B4AFB7_MCL1-01      ----DTTCLQGVLTPPLGTAHICGSPHPRPTALVMKNEL------LNKNT
B9ZYL7_BCL2-01          ---MAHPRRGGYDHRDIVVKYIHYKLSQKGYAWEEGRQQ------VSAEH
A0A452I9V7_BCL2-01      STSARAWSQRGYDNREIVLKYIHYKLSQRGYDWAA------------NEN
H9GPE7_BCL2-01          ---MAHPGIRGYDNREIVLRYIHYKLSQKGYDWVA---------------
A0A3Q2HRY3_BCL2-02      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
K7F5Y4_BCL2-02          ---MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAA------------NEN
K7F5Y4_BCL2-01          ---MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAA------------NEN
F6YNL8_BCL2-01          --MMAHPGRRGYDNREIVMKYIHYKLSQRGYEWDA------------GDL
H0YUX3_BCL2-01          ---MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAA------------GED
H0W1T3_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
J9NXG3_BCL2-02          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GE-
G1LID1_BCL2-02          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
I3MVK9_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
G1TW27_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
P10417_BCL2-02          ---MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
A0A096MPU7_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
P10417_BCL2-01          ---MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
Q7TSN8_BCL2-01          ---MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
Q6R755_BCL2-01          ---MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDV------------GD-
Q9JJV8_BCL2-01          ---MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDV------------GD-
Q923R6_BCL2-01          ---MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDV------------GD-
F1LNV0_BCL2-01          ---MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDT------------GD-
P49950_BCL2-01          ---MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDT------------GD-
H2NWH5_BCL2-01          ---MAHAGTTGYDNREIVDEXIHYKLSQRGYEWDA------------GD-
A0A3Q2HRY3_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
A0A2K6G3I7_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLAQRGYEWDA------------GD-
A0A287APJ6_BCL2-03      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
H0WKI0_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
A0A2K5UDI5_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
A0A2K5EB04_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
A0A2R8MY14_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA------------GD-
Q568V1_MCL1-01          ------------------MSFLAQGVQTPTLKTCV------------EDE
Q1L8X3_MCL1-01          ------MALSLDFRRTATMSFFAQGVQTPTLKTCV------------EDE
Q9I9N3_MCL1-01          ------MALSLDFRRTATMSFFAQGVQTPTLKTCV------------EDE
A0A3B3ICL7_BCL2L1-      ---------MSHCNRELVRFYLAYKMSCRDYPVSL------------LK-
A0A3B3E2W4_BCL2L1-      ---------MSHCNRELVQFYLGYKMSSRDYPVSL------------LK-
A0A3B5B4X7_BCL2L1-      ------MEIMSYSNRELVEFFISYKLSQRNYPTSL------------LR-
A0A3B4BFZ8_BCL2L1-      ---------MSPSNRELVEFFISYKLSQKNYPSSL------------LM-
A0A3Q3FUB6_BCL2L1-      ---------MSYSNRELVEFFISYKLSQRNYPTYV------------LR-
A0A3B5MGS2_BCL2L1-      ---------MAYSNRELVEFYISYKLSQRNYSSSL------------LR-
M4A558_BCL2L1-01        ---------MAYSNRELVEFYISYKLSQRNYSSSL------------LR-
A0A3P9QFB3_BCL2L1-      ---------MSYSNRELVEFYISYKLSQRNYSSSL------------LR-
A0A087YBW4_BCL2L1-      ---------MSYSNRELVEFYISYKLSQRNYSSSL------------LR-
A0A3B3VWI7_BCL2L1-      ---------MSYSNRELVEFYISYKLSQRNYSSSL------------LR-
A0A3B3XN57_BCL2L1-      ---------MSYSNRELVEFYISYKLSQRNYSSSL------------LR-
A0A3Q2C6K4_BCL2L1-      ---------MSYSNRELVEFYISYKLSQTNCPNSL------------LR-
A0A3Q2NRP4_BCL2L1-      ---------MSYSNRELVEFYISYKLSQTNCPNSL------------LR-
A0A0B4KJI5_BCL2L1-      ---------MSYSNRELVESFLSYKLSQRNYPTAL------------LR-
A0A3Q1JZ46_BCL2L1-      ------MEEMSNSNRELVEFFIMYKLSQRNHPASL------------LR-
A0A3Q1JZ46_BCL2L1-      ------MEEMSNSNRELVEFFIMYKLSQRNHPASL------------LR-
A0A3Q3NFM4_BCL2L1-      ---------MSYSNRELVEFFISYKLSQKNYPTSL------------LR-
A0A3Q3NFM4_BCL2L1-      ---------MSYSNRELVEFFISYKLSQKNYPTSL------------LR-
A0A3B4V9K8_BCL2L1-      ---------MSYSNRELVEFFISYKLSQSNCPTSL------------LR-
A0A3B4XS24_BCL2L1-      ---------MSYSNRELVEFFISYKLSQSNCPTSL------------LR-
C1BLI0_BCL2L1-01        ---------MSYSNRELVVFFISYKLSQRNYPISQ------------LG-
C0HAD8_BCL2L1-01        ---------MSYSNRELVVFFISYRLSQRNYSCCQ------------LG-
A0A3B3ZN55_BCL2L1-      ----------MSLNRELVEFYIQYKLSQRDCPLGL------------ED-
A0A3B5K6B9_BCL2L1-      ----------MSQNRELVIFYIKYKLSQRNYPFNH------------NGL
A0A3B5K6B9_BCL2L1-      ----------MSQNRELVIFYIKYKLSQRNYPFNH------------NGL
H3CH49_BCL2L1-01        AKSKGASTQRMSLNRELVIFYIKYKLSQRNYPLSH---------------
A0A3B3TFR4_BCL2L1-      ---------MSYSNRELVEYFVSYKLAQKNYSIAH------------II-
A0A3Q2FR43_BCL2L1-      ----------MSQNRELVLFYIKFKLSQRNYPVNH------------IM-
A0A3P8XYL5_BCL2L1-      ---------MTYNNKELVAYYITYKLSQRNYPINH------------TG-
Q90Z98_BCL2L1-02        ---------MSYYNRELVVFFIKYKLSQRNYPCNH------------IG-
Q90Z98_BCL2L1-01        ---------MSYYNRELVVFFIKYKLSQRNYPCNH------------IG-
A0A059PJI5_BCL2L1-      ---------MSYYNRELVVYFIKYKLSQKNYPCDH------------IG-
A0A3B4DTL9_BCL2L1-      ---------MSYYNRELVVYFIKYKLSQRNYPYNH------------IG-
B5XAY3_BCL2L1-01        --------MMTYNNRELVVYYITYKLSQRDYPFNH------------ME-
W5MG74_BCL2L1-01        --------KMSYSNRDLVVYYINYKLSQKNYSWDQ------------FS-
A0A3Q3B3X5_BCL2L1-      ----------MSQNKELVLFYIMYKLSQRNYPVNH------------II-
A0A3B3IB64_BCL2L1-      ----------MSRNRELVVFYVKYKLSQRNYPLNH------------IV-
A0A3P9JYH1_BCL2L1-      ----------MSRNRELVVFYVKYKLSQRNYPLNH------------IV-
A0A3B3DHA1_BCL2L1-      ----------MSRNRELVVFYVKYKLSQRNYPLNH------------IV-
A0A3Q0RTF8_BCL2L1-      ----------MSQNRELVLFYITYKLSQRNYPLNH------------IV-
I3IZK7_BCL2L1-01        --------YKMSQNRELVLFYIRYKLSQRNYPLNH------------IV-
A0A2U9BY16_BCL2L1-      ----------MSQNKELVVFYIQYKLSQRKYPLNH------------MG-
A0A0D6DR75_BCL2L1-      ----------MSQNRELVVYYITYKLSEKNYPLNH------------LG-
A0A3Q3WIW8_BCL2L1-      ----------MSVNRELVAYYINYKLSHRGCPLNH------------MG-
A0A219P0Y3_BCL2L1-      ----------MCQNRELVVCYIKYKLTQRNYPLNH------------MG-
A0A3Q3MX20_BCL2L1-      ----------MSQNRELVVFYIKYKLSQRNYPLIY------------IE-
A0A3Q3G2E1_BCL2L1-      ----------MSQNRELVVFYITYKFSQRNYPLNH------------ME-
A0A3Q3G2E1_BCL2L1-      ----------MSQNRELVVFYITYKFSQRNYPLNH------------ME-
A0A3Q3G2E1_BCL2L1-      ----------MSQNRELVVFYITYKFSQRNYPLNH------------ME-
A0A3Q1GZ93_BCL2L1-      ----------MSQNRELVVFYITYKLSQRNYPLNH------------LG-
A0A3Q1GZ93_BCL2L1-      ----------MSQNRELVVFYITYKLSQRNYPLNH------------LG-
A0A3Q1GZ93_BCL2L1-      ----------MSQNRELVVFYITYKLSQRNYPLNH------------LG-
A0A3B4V3T1_BCL2L1-      ----------MSQNRELVVFYIKHKLSQRNYPLTH------------ME-
A0A3B4XU17_BCL2L1-      ----------MSQNRELVVFYIKYKLSQRNYPLTH------------ME-
A0A3B3QRZ2_BCL2L1-      ---------MSYSNRELVMDFITYKLSQRNYN-GH------------FG-
A0A3B3ZN55_BCL2L1-      ----------MSLNRELVEFYIQYKLSQRDCPLQH------------LG-
G3NJY1_BCL2L1-01        ----------MSQNRELVVFYINYKLSQRNLPLNH------------IG-
A0A3Q3DUT7_BCL2L1-      ----------MSQNRELVLFYIRYKLSQKNYPLNH------------IG-
A0A3Q3DUT7_BCL2L1-      ----------MSQNRELVLFYIRYKLSQKNYPLNH------------IG-
A0A3Q3DUT7_BCL2L1-      ----------MSQNRELVLFYIRYKLSQKNYPLNH------------IG-
A0A3B1JJ42_BCL2L1-      --------VMSYYNRELVVYFIKYKLSQRNYPTNH------------IG-
A0A3P8UWG7_BCL2L1-      -------TLTFNINRKLVVDYIQYKLSQRNFPVHH------------LG-
A0A3Q3IVF5_BCL2L1-      ----------MSQNKELVVFYITYKLSQKNYPLSH------------LG-
A0A3Q1DHJ3_BCL2L1-      ----------MSQNRELVVFYIKYKLSQRNYPLNH------------MV-
A0A3Q1DHJ3_BCL2L1-      ----------MSQNRELVVFYIKYKLSQRNYPLNH------------MV-
A0A3Q1DHJ3_BCL2L1-      ----------MSQNRELVVFYIKYKLSQRNYPLNH------------MV-
A0A3P8TL99_BCL2L1-      ----------MSQNRELVVFYIKYKLSQRNYPLNH------------MV-
A0A3P8TL99_BCL2L1-      ----------MSQNRELVVFYIKYKLSQRNYPLNH------------MV-
A0A3Q1GS47_BCL2L1-      ----------MSQNRELVVFYIKYKLSQRNYPLNH------------MV-
A0A3B4Z3X2_BCL2L1-      ----------MSQNRELVVYYIKYKLSQRNYPLNH------------MV-
A0A3B4Z3X2_BCL2L1-      ----------MSQNRELVVYYIKYKLSQRNYPLNH------------MV-
C3VIT1_BCL2L1-01        ----------MSQNRELVVFYIKYKLSQRNYPLNH------------IV-
A0A3P8P0F1_BCL2L1-      ----------MSQNRELVLFYIRYKLSQRNYPLNH------------IV-
A0A3Q2X557_BCL2L1-      ----------MSQNRELVLFYIRYKLSQRNYPLNH------------IV-
A0A3P9D632_BCL2L1-      ----------MSQNRELVLFYIRYKLSQRNYPLNH------------IV-
A0A3P9D632_BCL2L1-      ----------MSQNRELVLFYIRYKLSQRNYPLNH------------IV-
A0A3Q4N4B5_BCL2L1-      ----------MSQNRELVLFYIRYKLSQRNYPLNH------------IV-
A0A3B4FNX1_BCL2L1-      ----------MSQNRELVLFYIRYKLSQRNYPLNH------------IV-
A0A3Q2QPL9_BCL2L1-      ----------MSQNRELVLSYVKFKLSQRNYPVNH------------IM-
A0A3B5PQJ0_BCL2L1-      ----------MSRNRELVLFYIKFKLSQRNYPIQH------------IL-
A0A087X9B7_BCL2L1-      ----------MSRNRELVLFYIKFKLSQRNYPIQH------------IL-
A0A3B3TUS7_BCL2L1-      ----------MSRNRELVLFYIKFKLSQRNYPIQH------------IL-
A0A3B3WI27_BCL2L1-      ----------MSRNRELVLFYIKFKLSQRNYPIQH------------IL-
A0A3P9N9Y4_BCL2L1-      ----------MSRNRELVLFYIKFKLSQRNYPIQH------------IL-
A0A3Q3BEB7_BCL2L1-      ---------MSHSNRDLVQFYISYKLSQRNCSKSL------------LM-
A0A3P8VMA1_BCL2L1-      ---------MSCSNRELVKFFLGYKLSQRNYPESL------------LM-
A0A345BSW9_BCL2L1-      ---------MSYYNRELVVFFIKYKLSQRNYPCNH------------IG-
A0A286MU87_BCL2L1-      ---------MSYSNRELVVFFISYRLSQRNYSCCQ------------LG-
A0A3P8XFS0_BCL2L1-      ---------MSYSNRELVVFFINYKLSQRNYSCCE------------LE-
A0A3P8XFS0_BCL2L1-      ---------MSYSNRELVVFFINYKLSQRNYSCCE------------LE-
A0A0F7L1T6_BCL2L1-      ---------MSYNNRELVEHFLRYKLSQRNYPSSL------------LR-
H2U5I3_BCL2L1-01        ---------MSYNNRELVEHFLRYKLSQRNYPTSL------------LR-
H2U5I3_BCL2L1-02        ---------MSYNNRELVEHFLRYKLSQRNYPTSL------------LR-
A0A3Q3J5K3_BCL2L1-      ---------MSYSHRELVEFYISYKLSQRNYSTSL------------LR-
A0A3Q1EVP6_BCL2L1-      ---------MSCSNRELVEFFISYKLSQRNYPMSL------------LR-
A0A3Q1BQA0_BCL2L1-      ---------MSYSNRELVEFFVSDKLSQRNYPTSL------------LR-
A0A3P8U812_BCL2L1-      ---------MSYSNRELVEFFVSYKLSQRNYPTSL------------LR-
E6ZFR0_BCL2L1-01        ---------MSYSNRELVEFFISYKLSQRNHPTSL------------LR-
G3P7B4_BCL2L1-01        ---------MANINRELVEFFLSYKLSQKNHPTSL------------LR-
A0A3Q3X5M5_BCL2L1-      ---------MSHSNRELVEFFISYKLTQKNYPTSL------------LR-
A0A2U9BIG9_BCL2L1-      ---------MSDSNRELVEFFIGYKLSQRNYPTSL------------LR-
A0A3B3C5I4_BCL2L10      DGFSAQKMSCGLRKETLAVALDYLSLSCRSPVL-----------------
A0A3Q2Y539_MCL1-01      NFKVGLVDALMLPPKAVVQGSMASQLQEVERRS-D------------NSD
H3AR18_MCL1-02          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------MMSPQDMCSYNKKTADIVPRV------------AVR
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-02      ----------MVRLFGVGLRVVHYAKYPKTVFPSL------------LAK
A0A3B4C6H5_MCL1-03      --------------MMMSPKEMYFDK--KTVFPSL------------LAK
A0A3Q1IAB0_BCL2L10      ----------------------MFQLSWGLFLLEA------------ESA
Q5XGJ4_BCL2L2-01        ------MAQSELGSRALVEDFVRYKLCQRSLVP-----------------
A0A3P8WUE9_BCL2-01      YLVPNSAGMASECNRYIVEKYICHKLAKRGYVW-E------------HDE
A0A3Q3G1D7_BCL2-01      --------MANECNRNIVEKYICHKLSKRGYEW-G------------FED
A0A3B4A3G8_BCL2-01      --------MANDCNRNIVEKYICHKLSKRGFAW-G------------FHE
D2ITA2_BCL2L1-02        ---MSIDTSMSISNRELVFFFLSHKLSQRNYRPIP------------FQP
A0A452FIG6_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGFSW-S------------LRR
A0A452FIG6_BCL2L1-      ---------MSQSNRELVVDFLSYKLSQKGFSW-S------------LRR
Q8UWD6_MCL1-01          NNDNGFWPCTGLQSKPLVIPEL------------K------------AHN
F8W4Q8_MCL1-01          NNDNGFWPCTGLQSKPLVIPEL------------K------------AHN
Q568W5_MCL1-01          NNDNGFWPCTGLQSKPLVIPEL------------K------------AHN
M3Y8D1_BCL2L10-01       ---MGVAAPPWAEAQRDLENRVGSGSAGRGRAM-A------------DAL
H3ANS8_BCL2L1-01        ---------KMSFNRLLVVDHISQKLMQRGYQWRE------------VGE
F7G6M3_BCL2L2-01        PRMATPAPASVSDTRALVADFVGYKLRQKGFAC-G------------AG-
G1TV33_BCL2L2-01        ARMATPASA--PDTRALVADFVGYKLRQKGYVC-G------------AG-
A0A2K5CWZ4_BCL2L2-      ARMATPASA--PDTRALVADFVGYKLRQKGYVC-G------------AG-
A0A2R8M4C0_BCL2L2-      ARMATPASA--PDTRALVADFVGYKLRQKGYVC-G------------TG-
G3TMU7_BCL2L2-01        ARMATPASA--PDTRALVADFVGYKLRQKGYVC-G------------AG-
A0A2K5CWZ4_BCL2L2-      ARMATPASA--PDTRALVADFVGYKLRQKGYVC-G------------AG-
A0A2K6TM77_BCL2L2-      ARMATPASA--PDTRALVADFVGYKLRQKGYVC-G------------AG-
A0A3P8W7K5_BCL2L10      NSASPSAVSTSSEQSDIAGRKMSCGLWKETLAV-A------------EDY
A0A3B3ICL7_BCL2L1-      ------------MTKWKKSWHLTYKMSCRDYPV-S------------LLK
A0A452U2H8_BCL2A1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
F7BXJ7_BCL2-01          ---MAHPRRGGYDHRDIVVKYIHYKLSQKGYEW-E------------EGR
A0A3B3TCS4_BCL2-01      -----MANDVPYDSRNIVEIYIYHKLLKTGYVW-E------------FQA
H0Z8G3_BCL2L1-01        ---------MYSSNRELVIDFVSYKLSQKGYSW-S------------QLE
U3JSL7_BCL2L1-01        ---------MYSSNRELVIDFVSYKLSQKGYSW-S------------QLE
Q4U2V6_BCL2L1-01        ---------MSSSNRELVIDFVSYKLSQKGYSW-S------------QLE
A0A3P8YNB4_BCL2-01      --------MADDDNRFIVEKYICHKLLKRGYAW-D------------FED
A0A3P9AAB2_BCL2-01      -----MANENPYDSRVIVENYIYDKLLKNGFVW-E------------FQT
A0A0U3DHY6_BCL2-01      -----MANENPYDSRFIVEKYIHNKLLKKGFVW-E------------FQA
X4ZGI8_BCL2-01          -----MANEIRYDNRNIVEKYLNHKLSKKGYEW-K------------FQS
U3KEW4_BCL2-01          ---MAHPGRRGYDNREIVLKYIHYKLSQRGYDW-A------------AGE
Q00709_BCL2-01          ---MAHPGRRGYDNREIVLKYIHYKLSQRGYDW-A------------AGE
K7F5Y4_BCL2-03          ---MAHPGRRGYDNREIVLKYIHYKLSQRGYDW-A------------ANE
G3WZW9_BCL2-01          ---MAHPGRRGYDNREIVMKYIHYKLSQRGYEW-D------------AGN
A0A452R145_BCL2-02      ----------------------------------M------------PET
M3YYK3_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRG--------------------
P10415_BCL2-04          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2K6R2I6_BCL2-02      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
J9NXG3_BCL2-01          ------------------MKYIHYKLSQRGYEW-D------------AGE
A0A1D5QRF2_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2R9APW6_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
G3ULB7_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-E------------AGE
A9QXG9_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2K5NZS5_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A0D9S017_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2K6CIX3_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2K5XRD4_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2K6KHG1_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2K6R2I6_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2K5HK49_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
G3QES9_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2I3GZF9_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2K6UEL3_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
P10415_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
P10415_BCL2-02          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
H2QEM8_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A2U4BHU7_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGV
Q75SV7_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGE
M3X1R9_BCL2-01          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A076FU27_BCL2-01      ---MAHAGGTGYDNREIVMKYIHYKLSQRGYEW-D------------ARA
F6R2C4_BCL2-01          ---MAHAGGTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
O02718_BCL2-01          ---MAHAGGTGYDNREIVMKYIHYKLSQRGYEW-D------------AGD
A0A076FZV9_BCL2-01      ---MAHAGGTGYDNREIVMKYIHYKLSQRGYEW-D------------AGA
A0A452EV13_BCL2-01      ---MAHAGGTGYDNREIVMKYIHYKLSQRGYEW-D------------AGA
G1LID1_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-01      ----------------------------------M------------PET
G3WZW9_BCL2-02          LGIMAHPGRRGYDNREIVMKYIHYKLSQRGYD------------------
G3ULB7_BCL2-02          ---MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-E------------AGE
A0A452T603_BCL2-01      ---MAHAGRTGYDNREIVMKYIHYKLSQRGYD------------------
G3PJT0_MCL1-01          --MNIIQRPKLAALNMT-GVMSCIILPQNGVAP-----------------
A0A3Q3VP02_MCL1-01      ----------------------MNVLFQNGVVSGPTR-------------
A0A3B5K5B3_MCL1-01      ----------MNIIANHTALRIMNVVFQNGVVDGAGH-------------
H2MLZ3_MCL1-01          ------------MFPLQKQMVNSYITSNCGFTGHILGSR--------AGE
H2MLZ3_MCL1-02          ------------MFPLQKQMVNSYITSNCGFTGHILGSR--------AGE
A0A3B3CEX1_MCL1-02      ------------MLPLQKHMVNSYITPSCGCTALFGG----------AGE
A0A3B3CEX1_MCL1-01      ------------MLPLQKHMVNSYITPSCGCTALFGG----------AGE
A0A3Q3B4V7_MCL1-01      --------------MFPKPKPSYIFFLQNGVVDGLHR------------D
A0A3Q3B4V7_MCL1-02      --------------MFPKPKPSYIFFLQNGVVDGLHR------------D
A0A3Q2EDX8_MCL1-01      --------------------MSYLILPQNGVVDGQTHYS--------PEI
A0A3Q2T2A9_MCL1-02      -----------MSKAPTSTQLVNCLISQNGVGDGQPHYR--------PGL
A0A3Q2T2A9_MCL1-01      -----------MSKAPTSTQLVNCLISQNGVGDGQPHYR--------PGL
A0A3B5PQ55_MCL1-02      ------------MTANSTNALNYLIFSQNGVGNGQTHYD--------QGL
A0A3B5PQ55_MCL1-01      ------------MTANSTNALNYLIFSQNGVGNGQTHYD--------QGL
A0A3P9Q4R7_MCL1-02      ------------MTANSTTALNYLIFSQNGVGNGQTHYD--------QGL
A0A3P9Q4R7_MCL1-01      ------------MTANSTTALNYLIFSQNGVGNGQTHYD--------QGL
A0A087X830_MCL1-01      ------------MTANSTTALNYLIFSQNGVGDGQTHYD--------QGL
A0A3B3YCD0_MCL1-01      ------------MTANSTTALNYLIFSQNGVGDGQTHYD--------QGL
A0A3P8VKS9_MCL1-02      --MNII-KNNQAKLNVATGVLGCFIVPQNGVVNGTMHYG--------TGN
A0A3P8VKS9_MCL1-01      --MNII-KNNQAKLNVATGVLGCFIVPQNGVVNGTMHYG--------TGN
A0A3P8VKS9_MCL1-05      --MNII-KNNQAKLNVATGVLGCFIVPQNGVVNGTMHYG--------TGN
A0A3P8VKS9_MCL1-04      --MNII-KNNQAKLNVATGVLGCFIVPQNGVVNGTMHYG--------TGN
A0A3P8VKS9_MCL1-03      --MNII-KNNQAKLNVATGVLGCFIVPQNGVVNGTMHYG--------TGN
I3JHR5_MCL1-01          -------MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYG--------SGK
A0A3Q4HLQ8_MCL1-01      -------MTNYMMSKRNQCTFIDYLIPQNGVLEGPMHYG--------SGN
A0A3P8NP63_MCL1-02      -------MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYG--------SGN
A0A3P8NP63_MCL1-03      -------MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYG--------SGN
A0A3Q2VNL8_MCL1-01      -------MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYG--------SGN
A0A3P8NP63_MCL1-01      -------MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYG--------SGN
A0A3P9BVM3_MCL1-01      -------MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYG--------SGN
A0A3B4G4Z6_MCL1-01      -------MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYG--------SGN
A0A2U9CJ81_MCL1-01      --MNIIPSTKRAAFNVTTGVMGCLILPQNGVVEGAMHYG--------SGN
A0A3Q3IZW0_MCL1-01      --MNIITSKKWADVNVTTEIM-SLILPQNGVVEGSMHCG--------S-N
A0A3Q1GX28_MCL1-02      ---MLPSGRTAMKL-ATGGMS-CLMLPQNGVVE----YS--------SGV
A0A3Q1GX28_MCL1-01      ---MLPSGRTAMKL-ATGGMS-CLMLPQNGVVE----YS--------SGV
A0A3B4XKA5_MCL1-01      --MNLIQAPKQAAL-T--AVN-YCICRQNGGLE-TWRDS--------SGD
A0A3Q3GP42_MCL1-01      --MDIINMKRAAVS-VSAGVM-SFMMPQNGVGKGQMHYG--------PEA
A0A3Q3M6G2_MCL1-02      --MSFIPSTRRAAL-IP-GVM--IVLPQDGVLEGPVHYD--------SRD
A0A3Q3M6G2_MCL1-01      --MSFIPSTRRAAL-IP-GVM--IVLPQDGVLEGPVHYD--------SRD
W5MMB7_MCL1-01          -----MSLSSLKRTSASAVIQLYCPNATTIHPGLASLGPCPGGSAARTAV
A0A3B3R4U0_MCL1-01      -----MNLINRTTATGLF-----CPGIKNGVKQNGFYSF--------VSA
A0A3B3SG34_MCL1-01      -----MNPQSLKSYAPIMVSMNYHRPLHHGVLGKSILQC---LDSSARAA
Q4SW32_MCL1-01          -----MSVIANRTAIDTM-----NVMFQNGVGDADLSSS-----------
D2ITA0_MCL1-03          ----MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGA
D2ITA0_MCL1-04          ----MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGA
Q0KFR9_MCL1-01          -----MSLSNSITRATTT-----MLHFQNGGSSYLADDARPLYYFQGAGA
A0A3P8Y1W8_MCL1-01      -----MNLSKSLTRATTT-----MLNVQNGVVGSLYSGA-PLCYFSPTGP
A0A3P8Y1W8_MCL1-02      -----MNLSKSLTRATTT-----MLNVQNGVVGSLYSGA-PLCYFSPTGP
A0A3Q2XZL8_MCL1-01      -----MSMVQ--PTSQVLKPQGRPMRPQNGVAEGLLQCN--------SPP
A0A3B4AFB7_MCL1-02      -----MNIINSPKRTALKLSTMGLFLPQNGLAEGDMHCG--------AAD
A0A3B3VM25_MCL1-01      ------------MTANSTTALNYLIFSQNGVGDGQTHYD--------QGL
A0A3Q0RA11_MCL1-03      ----MNTCTMRNCRMGSYKNVMDLFLPQNGVVDGTMHYG--------SGN
A0A3Q0RA11_MCL1-01      ----------------------------------SLPF------------
A0A3B4T8L9_MCL1-02      -----MNLIQ-SPKPTAFTAMNYCICRQNGGLETWTD-G--------SGD
A0A3B4T8L9_MCL1-01      -----MNLIQ-SPKPTAFTAMNYCICRQNGGLETWTD-G--------SGD
A0A3Q1EQB9_MCL1-02      -----MNMIP--TKRTTL--MNCLIFPQNGVVEGPMHYG--------SGD
A0A3B4ZKP6_MCL1-01      -----MNIIP-TTKRTAL--MSCFILPQNGVVEGQMHYG--------SGD
A0A3Q1BKL8_MCL1-02      -----MNMIPTTTKRTAF--MNYLIFPQNGVVEGPMHYG--------SGD
A0A3Q1EQB9_MCL1-01      -----MNMIP--TKRTTL--MNCLIFPQNGVVEGPMHYG--------SGD
A0A3Q1BKL8_MCL1-01      -----MNMIPTTTKRTAF--MNYLIFPQNGVVEGPMHYG--------SGD
A0A3P8RQX7_MCL1-02      -----MNMIPTTTKRTAF--MNYLIFPQNGVVEGPMHYG--------SGD
A0A3P8RQX7_MCL1-01      -----MNMIPTTTKRTAF--MNYLIFPQNGVVEGPMHYG--------SGD
U3JTB2_BCL2A1-01        -----METAEFYYVYYLAQDYLQYVLQES-------HLG-----------
H0ZCL9_BCL2A1-01        -----METAEFYYVYYLAQDYLQYVLQES-------HLG-----------
Q9W6F2_BCL2A1-01        -----METAEFYYVYYLAQDYLQYVLQES-------HLG-----------
G1N8C5_BCL2A1-01        -----METAEFYYVYYLAQDYLQYVLQES-------RLG-----------
A0A452J3N6_BCL2A1-      -----MESSEYCYVYYLVQDYLKYVLQEP-------QLG-----------
K7G130_BCL2A1-01        -----MESSEFRYVYYLVQDYLKYILQEP-------ELG-----------
F6SFL4_BCL2A1-01        -----MDDYEFHYVHMLARDYLKHVQQTP-------PLG-----------
G3WSP8_BCL2A1-01        -----MADCEFHYVHMLAQDYLKHVQQMP-------RLG-----------
F6S8G3_BCL2A1-01        -----MDDGVFWSVRALALDYLDDVLQTP-------RLG-----------
G1T1L8_BCL2A1-01        SEQQKMSDCEFGYVHTLAQDYLLYILKTP-------QPG-----------
O55178_BCL2A1-01        -----MAEYELMHIHSLAEHYLQYVLQVP-------AFE-----------
Q0P538_BCL2A1-01        -----MAEYELMHIHSLAEHYLQYVLQVP-------AFE-----------
A0A337STN9_BCL2A1-      -----MADGEFGYVLTLARDYTEHVLQGP-------QPG-----------
A0A337STN9_BCL2A1-      -----MADGEFGYVLTLARDYTEHVLQGP-------QPG-----------
E2RS00_BCL2A1-01        -----MTDCEFGYTLALAQDYVRHVLQIP-------QPG-----------
M3YVH4_BCL2A1-01        -----MTDSEFGYTLSLAQDYVRHVLQIP-------QPS-----------
A0A452SIR9_BCL2A1-      -----MTDCEFGYTLTLAQDYVKHVLQIP-------QPG-----------
G3V977_BCL2A1-01        -----MTDCEFMYIHSLAENYLQYVLQVP-------AFE-----------
Q925A9_BCL2A1-01        -----MTDCEFMYIHSLAENYLQYVLQVP-------AFE-----------
Q07440_BCL2A1-01        -----MAESELMHIHSLAEHYLQYVLQVP-------AFE-----------
O55179_BCL2A1-01        -----MSEYEFMYIHSLAEHYLQYVLQVP-------AFE-----------
O55177_BCL2A1-02        -----MAEYEFMYIHSLAEHYLQYVLQVP-------AFE-----------
Q497M6_BCL2A1-01        -----MAEYEFMYIHSLAEHYLQYVLQVP-------AFE-----------
Q8K164_BCL2A1-01        -----MAEYEFMYIHSLAEHYLQYVLQVP-------AFE-----------
Q4FK02_BCL2A1-01        -----MSEYEFMYIHSLAEHYLQYVLQVP-------AFE-----------
I3MCZ7_BCL2A1-01        -----MNDCEFRFIHTLAQDYLQHVLQVP-------QRG-----------
G3T8E6_BCL2A1-01        -----MTDCEFGYIYKLVQDYLKYVLQIP-------QPA-----------
H0WZ23_BCL2A1-01        -----MTDCEFGYIHRLAQDYLQYVLQIQ-------QCG-----------
A0A2K6TLM0_BCL2A1-      -----MTDHEFGYIHNLTQDYLRYVLQIP-------QSG-----------
A0A2K5D2I1_BCL2A1-      -----MTDCEFGYIHNLTQDYLRYVLQIP-------QSG-----------
U3DBA0_BCL2A1-02        -----MTDSEFGYIHNLTQDYLQYVLQIP-------QSG-----------
A0A2K6TLM0_BCL2A1-      -----MTDHEFGYIHNLTQDYLRYVLQIP-------QSG-----------
B4E1X9_BCL2A1-01        -----MTDCEFGYIYRLAQDYLQCVLQIP-------QPG-----------
Q16548_BCL2A1-02        -----MTDCEFGYIYRLAQDYLQCVLQIP-------QPG-----------
A0A2I2YML2_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2R8ZJX9_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2I3T6T8_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2I3HNF3_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K6PHG5_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K6LV22_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
F7E8V5_BCL2A1-02        -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K5KHH9_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K6AD55_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K5TMD8_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K5KAB6_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K6DS80_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A096NMX5_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K6EKG1_BCL2A1-      -----MTDCEFGYTHRLVQDYLQYVLRVP-------QPG-----------
Q3C2I0_BCL2A1-01        -----MTDTEFGYVHGLAEDYLKYVLQIQ-------QPG-----------
A0A452EK63_BCL2A1-      -----MTDTEFDYVHKLAEDYLKYVLQIQ-------QPG-----------
W5Q0N6_BCL2A1-01        -----MTDTEFDYVHKLAEDYLKYVLQIQ-------QPG-----------
F7CP56_BCL2A1-01        -----MTDCEFGYIHMLAQDYLKYVLQIP-------QPG-----------
C7F841_BCL2A1-02        -----MTDDEFGYIHMLAQDYLKYVLQIP-------QPG-----------
C7F841_BCL2A1-01        -----MTDDEFGYIHMLAQDYLKYVLQIP-------QPG-----------
A0A2I3HNF3_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2I2YML2_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2R8ZJX9_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2I3T6T8_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
H2NNZ9_BCL2A1-01        -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
Q16548_BCL2A1-01        -----MTDCEFGYIYRLAQDYLQCVLQIP-------QPG-----------
A0A2I2YML2_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K6LV22_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K6PHG5_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2R8ZJX9_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2I3T6T8_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2I3HNF3_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K5KHH9_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K5KHH9_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K5KAB6_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K5TMD8_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
F7E8V5_BCL2A1-01        -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K6DS80_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K6AD55_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A096NMX5_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A0D9RRC3_BCL2A1-      -----MTDCEFGYIYRLAQDYLQYVLQIP-------QPG-----------
A0A2K5D2I1_BCL2A1-      -----MTDCEFGYIHNLTQDYLRYVLQIP-------QSG-----------
U3DBA0_BCL2A1-01        -----MTDSEFGYIHNLTQDYLQYVLQIP-------QSG-----------
A0A2K6TLM0_BCL2A1-      -----MTDHEFGYIHNLTQDYLRYVLQIP-------QSG-----------
R4JQR8_BCL2L1-01        --------MNQFSSRYLVADFINDRLRKHGMRWDNCPTL-----------
A0A346RRN1_BCL2L1-      --------MNQYSSRYLVVDFVNDRLRKNGLQWENCPSL-----------
Q99M66_BCL2L10-01       -----MGDPLQDRTRRLLTDYILFCARAPN------TPE-----------
F6ZPD4_BCL2L10-01       -----VAEALRERTALLLIDYLQRRAREPA------TP------------
Q9Z0F3_BCL2L10-01       --MADSQDPLHERTRRLLSDYIFFCAREPD------TPE-----------
E1B9B3_BCL2L10-01       TEGGAMVDPFRERTARLLMDYLEFCAREPG------TPA-----------
F1RZB9_BCL2L10-01       -----MADAFRERTARLLTDYLEYCAREPG------TAA-----------
G1T264_BCL2L10-01       QRRLAMADALEERTARLLTDYLECCAREPG------TPE-----------
F1MV39_BCL2L10-01       --VADGQESLVERTARLLMDYLEFCAREPG------TPA-----------
W5QIG4_BCL2L10-01       GRGGAMVDPFRERTARLLMDWLEFCAREPG------TPA-----------
A0A2K6F2Q2_BCL2L10      -----MGDRFRERTERLLADYLEYCTREPG------APG-----------
H0WZ06_BCL2L10-01       -----MADPLRERTERLLTDYLEYCARDPT------APE-----------
A0A2K6TIT7_BCL2L10      -----MADPLQQRTEQLVADYLEYCSREPG------TPE-----------
A0A2K5F974_BCL2L10      -----MADPLRQRTERLVADYLEYCSQEPG------TPE-----------
F7CT87_BCL2L10-01       -----MADPLRQRTEQLVTDYLEYCSREPG------TPE-----------
A0A0D9RG38_BCL2L10      -----MADPLRERTERLLADYLGCCAREPG------TPE-----------
A0A096NM44_BCL2L10      -----MADPLRERTERLLADYLGCCAREPG------TPE-----------
A0A2K6R5T5_BCL2L10      -----MADPLRERTERLLADYLGCCAREPG------TPE-----------
Q9HD36_BCL2L10-02       RERTTMADPLRERTELLLADYLGYCAREPG------TPE-----------
G1R3W6_BCL2L10-01       -----MVDQLRERTERLLADYLGCCAREPG------TPE-----------
A0A2K5K3B0_BCL2L10      RERTNVADPLRERTERLLADYLGCCAREPG------TPE-----------
A0A2K6M5H5_BCL2L10      RERTTVADPLRERTERLLADYLGCCAREPG------TPE-----------
A0A2K5TKG9_BCL2L10      -----MADPLRERTERLLADYLGCCAREPG------TPE-----------
F7H6U5_BCL2L10-01       -----MADPLRERTERLLADYLGCCAREPG------TPE-----------
A0A2K6B2D9_BCL2L10      -----MADPLRERTERLLADYLGCCAREPG------TPE-----------
A0A2K5MMZ4_BCL2L10      -----MADPLRERTERLLADYLGCCAREPG------TPE-----------
H2NN92_BCL2L10-01       RERTITADLLRERTERLLADYLGCCAREPG------TPE-----------
G3QLU6_BCL2L10-01       RERTTMADPLRERTERLLADYLGYCAREPG------TPE-----------
A0A2R9BCD9_BCL2L10      RERTTMADPLRERTERLLADYLGYCAREPG------TPE-----------
H2Q9G4_BCL2L10-01       RERTTMADPLRERTERLLADYLGYCAREPG------TPE-----------
Q9HD36_BCL2L10-01       RERTTMADPLRERTELLLADYLGYCAREPG------TPE-----------
A0A337RYG8_BCL2L10      -----MADALRERTAQLLTDYLEYCAREPG------SPA-----------
G1LKR4_BCL2L10-01       -----MADALRG-TARLLTDYLEYCAREPG------TPA-----------
A0A452QJG0_BCL2L10      -----MADALRERTARLLTDYLEYCAREPG------TPA-----------
P70345_BCL2L2-03        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F6VJQ0_BCL2L10-01       -------------EL-----------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
A0A2K5DMS4_MCL1-01      TKP-------MGRSE-----------------------------------
A0A3P8V8T6_MCL1-01      VES-----------------------------------------------
B6V6J0_MCL1-01          EESGELEASCLLQHG-----------------------------------
F7ETY1_MCL1-01          EETSGLKASFLLHHG-----------------------------------
A0A287APJ6_BCL2-01      GQLGLFGFTAYSSSK-----------------------------------
H3AR18_MCL1-01          TETAFRFGLDQWSGG-----------------------------------
F7G4L5_BCL2L2-04        --P---------GEG-----------------------------------
A0A2K6GWN0_BCL2L2-      --P---------GEG-----------------------------------
A0A2R8M4C0_BCL2L2-      --P---------GEG-----------------------------------
A0A2K5CWZ4_BCL2L2-      --P---------GEG-----------------------------------
A0A2I2YPX6_BCL2L2-      --P---------GEG-----------------------------------
A0A2K6TM77_BCL2L2-      --P---------GEG-----------------------------------
W5QDH5_BCL2L2-01        --P---------GEG-----------------------------------
D3Z5F7_BCL2L2-01        --P---------GEG-----------------------------------
A0A2K6MEE6_BCL2L2-      --P---------GEG-----------------------------------
A0A2K6RW46_BCL2L2-      --P---------GEG-----------------------------------
A0A384DPS8_BCL2L2-      --P---------GEG-----------------------------------
A0A2K5MZX9_BCL2L2-      --P---------GEG-----------------------------------
A0A2K5HEK7_BCL2L2-      --P---------GEG-----------------------------------
A0A2K5V0Q3_BCL2L2-      --P---------GEG-----------------------------------
F7G4L5_BCL2L2-05        --P---------GEG-----------------------------------
A0A2K6EA73_BCL2L2-      --P---------GEG-----------------------------------
A0A2K6AI30_BCL2L2-      --P---------GEG-----------------------------------
G1RYB4_BCL2L2-01        --P---------GEG-----------------------------------
A0A2R9A7B2_BCL2L2-      --P---------GEG-----------------------------------
H2Q805_BCL2L2-02        --P---------GEG-----------------------------------
A0A2I3MUE4_BCL2L2-      --P---------GEG-----------------------------------
A0A287AW74_BCL2L2-      --P---------GEG-----------------------------------
A0A384DPS8_BCL2L2-      --P---------GEG-----------------------------------
J7H260_MCL1-01          DSP-----------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          TGPKFSFQGLLGRFG-----------------------------------
R4GAJ0_MCL1-02          TGPKFSFQGLLGRFG-----------------------------------
G1QAV8_MCL1-01          --------------Q-----------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          AKP-------LGGSG-----------------------------------
A0A2K6GI15_MCL1-03      AKP-------MGRSG-----------------------------------
C8YZ26_MCL1-01          TKP-------MGRSG-----------------------------------
A0A2K5CFH3_MCL1-02      TKP-------MGRSG-----------------------------------
F7GTF7_MCL1-03          TKP-------MGRSG-----------------------------------
A0A2K6V5Y3_MCL1-03      TKP-------MGRSG-----------------------------------
A0A2K5LXU8_MCL1-03      TKP-------MGRSG-----------------------------------
A0A2K5I9Q7_MCL1-03      TQP-------MGRSG-----------------------------------
A0A2I2YQH7_MCL1-03      TKP-------MGRSG-----------------------------------
Q07820_MCL1-04          TKP-------MGRSG-----------------------------------
A0A2K5W0W9_MCL1-03      TKP-------MGRSG-----------------------------------
F7HUE9_MCL1-02          TKP-------MGRSG-----------------------------------
A0A2K6ECR0_MCL1-03      TKP-------MGRSG-----------------------------------
A0A2K5XSC7_MCL1-03      TKP-------MGRSG-----------------------------------
A0A2R9BYH6_MCL1-03      TKP-------MGRSG-----------------------------------
K7DE58_MCL1-03          TKP-------MGRSG-----------------------------------
A0A2I3M3D6_MCL1-03      TKP-------MGRSG-----------------------------------
A0A2K6KRW9_MCL1-03      TKP-------MGRSG-----------------------------------
A0A2K6PPL1_MCL1-03      TKP-------MGRSG-----------------------------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      GRP-------GRASS-----------------------------------
A0A1L1RNM6_MCL1-02      GRP-------GRASS-----------------------------------
F6ZMX1_MCL1-01          AKP-------LR--------------------------------------
A0A286Y1M5_MCL1-01      SKP-------LGGVG-----------------------------------
P97287_MCL1-02          SKP-------LGEAG-----------------------------------
P97287_MCL1-01          SKP-------LGEAG-----------------------------------
G3T756_MCL1-01          TKP-------MGGSG-----------------------------------
G1L3M8_MCL1-02          AKP-------LGGSG-----------------------------------
A0A2U3V2H3_MCL1-01      AKP-------LGGSG-----------------------------------
K9IWB2_MCL1-03          AKP-------MGGSG-----------------------------------
K9IWB2_MCL1-02          AKP-------MGGSG-----------------------------------
K9IWB2_MCL1-01          AKP-------MGGSG-----------------------------------
B4DU51_MCL1-01          TKP-------MGRSG-----------------------------------
A0A287DCH9_MCL1-02      AKP-------LRGSG-----------------------------------
A0A287DCH9_MCL1-01      AKP-------LRGSG-----------------------------------
A0A452GAH0_MCL1-02      AKP-------LGGSG-----------------------------------
A0A2K5I9Q7_MCL1-01      TQP-------MGRSG-----------------------------------
G1PZ39_MCL1-01          AKP-------LGGPA-----------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          AKP-------LGGSR-----------------------------------
A0A2K5C7L5_MCL1-01      TKP-------MDRSG-----------------------------------
Q9Z1P3_MCL1-01          AKP-------LGEAG-----------------------------------
A5PJR2_MCL1-01          AKP-------LGGSG-----------------------------------
A0A452GAH0_MCL1-01      AKP-------LGGSG-----------------------------------
G1L3M8_MCL1-01          AKP-------LGGSG-----------------------------------
F7AVA6_MCL1-01          TKP-------MGGSG-----------------------------------
G1T2Q0_MCL1-02          AKP-------MGRAG-----------------------------------
G1T2Q0_MCL1-01          AKP-------MGRAG-----------------------------------
M3XAP4_MCL1-01          AKP-------LGGSG-----------------------------------
Q7YRZ9_MCL1-01          AKP-------LGGSG-----------------------------------
J9PBC4_MCL1-02          AKP-------LGGSR-----------------------------------
Q8HYS5_MCL1-01          AKP-------LGGSR-----------------------------------
M3XZZ5_MCL1-01          AKP-------LGGPG-----------------------------------
A0A452RHX5_MCL1-01      AKP-------LGGSG-----------------------------------
H0XFB7_MCL1-01          AKP-------MGRAG-----------------------------------
A0A2K6GI15_MCL1-02      AKP-------MGRSG-----------------------------------
F7GTF7_MCL1-02          TKP-------MGRSG-----------------------------------
A0A2K5CFH3_MCL1-01      TKP-------MGRSG-----------------------------------
A0A2K6V5Y3_MCL1-01      TKP-------MGRSG-----------------------------------
A0A2K6KRW9_MCL1-01      TKP-------MGRSG-----------------------------------
A0A2K6PPL1_MCL1-01      TKP-------MGRSG-----------------------------------
A0A2K5XSC7_MCL1-01      TKP-------MGRSG-----------------------------------
A0A0D9RZP5_MCL1-01      TKP-------MSRSG-----------------------------------
A0A2K5W0W9_MCL1-02      TKP-------MGRSG-----------------------------------
I7G687_MCL1-01          TKP-------MGRSG-----------------------------------
F7HUE9_MCL1-01          TKP-------MGRSG-----------------------------------
A0A2K6ECR0_MCL1-01      TKP-------MGRSG-----------------------------------
A0A2I3M3D6_MCL1-02      TKP-------MGRSG-----------------------------------
A0A2K5LXU8_MCL1-01      TKP-------MGRSG-----------------------------------
A0A2I3GB35_MCL1-02      TKP-------MGRSG-----------------------------------
H2N5Y9_MCL1-01          TKP-------LGRSG-----------------------------------
Q07820_MCL1-01          TKP-------MGRSG-----------------------------------
A0A2R9BYH6_MCL1-01      TKP-------MGRSG-----------------------------------
K7DE58_MCL1-01          TKP-------MGRSG-----------------------------------
A0A2I2YQH7_MCL1-01      TKP-------MGRSG-----------------------------------
A0A2K5I9Q7_MCL1-02      TQP-------MGRSG-----------------------------------
M3XAP4_MCL1-02          AKP-------LGGSG-----------------------------------
A0A2K6GI15_MCL1-01      AKP-------MGRSG-----------------------------------
F7GTF7_MCL1-01          TKP-------MGRSG-----------------------------------
A0A2K5CFH3_MCL1-03      TKP-------MGRSG-----------------------------------
A0A2K6V5Y3_MCL1-02      TKP-------MGRSG-----------------------------------
A0A2K6KRW9_MCL1-02      TKP-------MGRSG-----------------------------------
A0A2K6PPL1_MCL1-02      TKP-------MGRSG-----------------------------------
A0A2K5LXU8_MCL1-02      TKP-------MGRSG-----------------------------------
A0A2K5W0W9_MCL1-01      TKP-------MGRSG-----------------------------------
A0A2K6ECR0_MCL1-02      TKP-------MGRSG-----------------------------------
A0A2I3M3D6_MCL1-01      TKP-------MGRSG-----------------------------------
A0A2K5XSC7_MCL1-02      TKP-------MGRSG-----------------------------------
A0A2I3GB35_MCL1-01      TKP-------MGRSG-----------------------------------
Q07820_MCL1-03          TKP-------MGRSG-----------------------------------
A0A2R9BYH6_MCL1-02      TKP-------MGRSG-----------------------------------
K7DE58_MCL1-02          TKP-------MGRSG-----------------------------------
A0A2I2YQH7_MCL1-02      TKP-------MGRSG-----------------------------------
G3WBC5_MCL1-01          TKP-------L---------------------------------------
W5QI41_MCL1-01          AKP-------LGGSG-----------------------------------
F1MQX4_MCL1-01          VKP-------LGGSG-----------------------------------
B4DLY8_MCL1-01          TKP-------MGRSG-----------------------------------
B4DG83_MCL1-01          TKP-------MGRSG-----------------------------------
B4E3L8_MCL1-01          TKP-------MGRSG-----------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
H3AAS7_BCL2L2-02        -----------------------------------APTD-----------
H3AAS7_BCL2L2-01        -----------------------------------APTD-----------
F6TEC3_BCL2L2-01        -----------------------------------A---G----------
G1Q051_BCL2L2-01        -----------------------------------GPGEG----------
G3WPT2_BCL2L2-01        -----------------------------------GPGEG----------
P70345_BCL2L2-01        -----------------------------------GPGEG----------
O88996_BCL2L2-01        -----------------------------------GPGEG----------
A0A3Q9B4M8_BCL2L2-      -----------------------------------GPGEG----------
H0XR82_BCL2L2-01        -----------------------------------GPGEG----------
Q92843_BCL2L2-02        -----------------------------------GPGEG----------
Q05KI8_BCL2L2-01        -----------------------------------GPGEG----------
Q1RMX3_BCL2L2-01        -----------------------------------GPGEG----------
Q45T69_BCL2L2-01        -----------------------------------GPGEG----------
A0A452ECF0_BCL2L2-      -----------------------------------GPGEG----------
A0A286XQQ9_BCL2L2-      -----------------------------------GPGEG----------
A0A2K5MZX9_BCL2L2-      -----------------------------------GPGEG----------
A0A0D9RU30_BCL2L2-      -----------------------------------GPGEG----------
A0A2K5HEK7_BCL2L2-      -----------------------------------GPGEG----------
F6PH48_BCL2L2-01        -----------------------------------GPGEG----------
A0A2I2UAE3_BCL2L2-      -----------------------------------GPGEG----------
A0A2I2YPX6_BCL2L2-      -----------------------------------GPGEG----------
I3ND50_BCL2L2-01        -----------------------------------GPGEG----------
A0A2K5V0Q3_BCL2L2-      -----------------------------------GPGEG----------
F7G4L5_BCL2L2-02        -----------------------------------GPGEG----------
F7G4L5_BCL2L2-03        -----------------------------------GPGEG----------
A0A2K6EA73_BCL2L2-      -----------------------------------GPGEG----------
A0A2K6AI30_BCL2L2-      -----------------------------------GPGEG----------
G1RYB4_BCL2L2-03        -----------------------------------GPGEG----------
A0A2R9A7B2_BCL2L2-      -----------------------------------GPGEG----------
H2Q805_BCL2L2-01        -----------------------------------GPGEG----------
A0A2I3MUE4_BCL2L2-      -----------------------------------GPGEG----------
A0A2K6GWN0_BCL2L2-      -----------------------------------GPGEG----------
A0A2K6MEE6_BCL2L2-      -----------------------------------GPGEG----------
A0A2K6RW46_BCL2L2-      -----------------------------------GPGEG----------
A0A2K6RW46_BCL2L2-      -----------------------------------GPGEG----------
A0A2K6TM77_BCL2L2-      -----------------------------------GPGEG----------
A0A287AW74_BCL2L2-      -----------------------------------GPGEG----------
A0A2U4CFE3_BCL2L2-      -----------------------------------GPGEG----------
A0A452SHI1_BCL2L2-      -----------------------------------GPGEG----------
A0A384DPS8_BCL2L2-      -----------------------------------GPGEG----------
F6U940_BCL2L2-01        -----------------------------------GPGEG----------
G3WPT2_BCL2L2-02        -----------------------------------GPGEG----------
W5QDH5_BCL2L2-02        -----------------------------------GPGEG----------
Q7TS60_BCL2L2-01        -----------------------------------GPGEG----------
G1LMC3_BCL2L2-01        -----------------------------------GPGEG----------
M3Y5X5_BCL2L2-01        -----------------------------------GPGEG----------
G1P3J2_BCL2L2-01        -----------------------------------GPGEG----------
I3ND50_BCL2L2-02        -----------------------------------GPGEG----------
P70345_BCL2L2-04        -----------------------------------GPGEG----------
Q6GLI5_BCL2L1-01        E----GPGATQG--------------------------------------
Q2TAP5_BCL2L1-01        TSERPGEGATQG--------------------------------------
Q91828_BCL2L1-01        TSERPGEGATQG--------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      -VRYGNPQWISGNPSWHLADSPTVNGATGHSRSL-DARKM----------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        EPANETGNTLNGSPSWHPSPSHVINGASEHPELLEEEEEE----------
Q07816_BCL2L1-04        AAEAEMDSVLNGSPSWHPPAGHVVNGATVHRSSL-EVHEI----------
Q07817_BCL2L1-02        ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
A0A2K5YR37_BCL2L1-      ESEMETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
A0A452E1B1_BCL2L1-      ESDMETPSAISGNPSWHLADSSVVNGATGHSRSL-DAGKM----------
W5PSA5_BCL2L1-01        ESDMETPSAISGNPSWHLADSPVVNGATGHSRSL-DTGKM----------
Q07816_BCL2L1-01        --EAEMDSVLNGSPSWHPPAGHVVNGATVHRSSL-EVHEI----------
Q07816_BCL2L1-03        --EAEMDSVLNGSPSWHPPAGHVVNGATVHRSSL-EVHEI----------
Q07816_BCL2L1-02        --EAEMDSVLNGSPSWHPPAGHVVNGATVHRSSL-EVHEI----------
G1N5N5_BCL2L1-01        --EAEMDSVLNGSPSWHPPAGHVVNGAAVHRSSL-EVHEI----------
A0A452ILL8_BCL2L1-      --EAEMASVPNGSPSWHPGASHIVNGAAGHSNSL-EAHER----------
A0A452ILL8_BCL2L1-      --EAEMASVPNGSPSWHPGASHIVNGAAGHSNSL-EAHER----------
K7F655_BCL2L1-01        --EAEMASVPNGSPSWHPGASHVVNGAAGHSNSL-EAHER----------
A0A287CZ07_BCL2L1-      ESEVETPSAINGNPSWHLADSPAINGATGHSSSL-DAREV----------
F6WA14_BCL2L1-01        ----EIPSTVNGSPSWHPADSRAVSGATGHSSSL-DAHET----------
G3WKX6_BCL2L1-01        ----EIPSTVNGSPSWHPADSRAVSGATGHSSSL-DAHET----------
F6WQI0_BCL2L1-02        ESEMETPSAINGNPSWHLADSPTGNGATGHSSSL-DAREV----------
G3SPN0_BCL2L1-01        ESEMEIPSAINGNPSRHLADSPAVNGATGHSSSL-DAREV----------
H0X6V2_BCL2L1-01        ESELETPSAINGNPSWHLADSPTVNGATGHSSSL-DAREV----------
Q2PFS6_BCL2L1-01        ---METPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
P53563_BCL2L1-02        EPERETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
P53563_BCL2L1-03        EPERETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
O35843_BCL2L1-01        EAERETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
G1RER8_BCL2L1-01        ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
Q64373_BCL2L1-01        EAERETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
Q64373_BCL2L1-09        EAERETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
P53563_BCL2L1-01        EPERETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
A0A2U3V0P1_BCL2L1-      ESDMETPSAINGNPSWHLADSPAVNVATGHSSSL-DAREV----------
O77737_BCL2L1-01        ESEAETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
Q9MYW4_BCL2L1-01        GPEMETPSAINGNPAWHPADSPAVNGATGHSSSL-DAREV----------
F6WQI0_BCL2L1-01        ESEMETPSAINGNPSWHLADSPTGNGATGHSSSL-DAREV----------
B2Z3Z4_BCL2L1-01        ESERETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
Q05KJ0_BCL2L1-02        ESDMETPSAINGNASWHLADSPAVNGATGHSRSS-DAREV----------
Q05KJ0_BCL2L1-01        ESDMETPSAINGNASWHLADSPAVNGATGHSRSS-DAREV----------
E2IV76_BCL2L1-01        ESEMETPSAINGNPSWHLADSPPANGATGHSSSL-DAREV----------
A0A2K6G3C5_BCL2L1-      ESEMETPSAINGNPSWHLADSPPANGATGHSSSL-DAREV----------
M3Z2H9_BCL2L1-01        ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
A0A0D9RJZ8_BCL2L1-      ESEMETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
A0A286Y5D6_BCL2L1-      ESEMETPSAINGNPSWHLTDSPTVNGATGHSSSL-DAREV----------
A0A1L5BWY3_BCL2L1-      ESEVETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
I3MUP5_BCL2L1-03        ESEVETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
I3MUP5_BCL2L1-01        ESEVETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
I3MUP5_BCL2L1-02        ESEVETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
G1P9D2_BCL2L1-01        ESEVETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
A0A2K5EBP4_BCL2L1-      DSEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
E2IV75_BCL2L1-01        DSEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
F7IT34_BCL2L1-01        DSEMETPSAINGNPSWHLADSPVVNGATGHSSSL-DAREV----------
F7IT34_BCL2L1-02        DSEMETPSAINGNPSWHLADSPVVNGATGHSSSL-DAREV----------
Q76LT7_BCL2L1-01        ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
A0A2K5M8B1_BCL2L1-      ESEMETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
A0A2K5H963_BCL2L1-      ESEMETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
M3XA94_BCL2L1-01        ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
Q8SQ42_BCL2L1-01        ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
G3RY91_BCL2L1-01        ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
Q07817_BCL2L1-01        ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
Q07817_BCL2L1-03        ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
A0A2K5VPG2_BCL2L1-      ESEMETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
F6UKR4_BCL2L1-01        ESEMETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
A0A2K5YR37_BCL2L1-      ESEMETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
A0A2J8VIH3_BCL2L1-      ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
A0A2K6LPM4_BCL2L1-      ESEMETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
A0A2K6QFA2_BCL2L1-      ESEMETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
A0A2K6QFA2_BCL2L1-      ESEMETPSAINGNPSWHLVDSPAVNGATGHSSSL-DAREV----------
A0A2K6UWY8_BCL2L1-      DSEMETPSAINGNPAWHLADSPAVNGATGHSSSL-DAREV----------
E2IV77_BCL2L1-01        DSEMETPSAINGNPAWHLADSPAVNGATGHSSSL-DAREV----------
A0A452SDS4_BCL2L1-      ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
A0A384D3U1_BCL2L1-      ESEMETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
A0A452FWV3_BCL2L1-      ESDMETPSAINGNPSWHLADSPAVNGATGHSRSL-DAREV----------
Q9MZS7_BCL2L1-01        ESDMETPSAINGNPSWHLADSPAVNGATGHSRSL-DAREV----------
Q64373_BCL2L1-03        EAERETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
Q64373_BCL2L1-04        EAERETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
P53563_BCL2L1-04        EPERETPSAINGNPSWHLADSPAVNGATGHSSSL-DAREV----------
A0A3B1IEV7_MCL1-01      SAKG----VSMGGGSLPDSPL-----------------------------
A0A3B4E3I4_MCL1-03      AAPGPASKAAMAGGSLPESPESDDFVPDF---------------------
A0A3B4E3I4_MCL1-02      GGQGGSSSSSAQTGS-PAAPELTHVQVNSISISSTKEQTTIS--------
A0A3B4E3I4_MCL1-01      GGQGGSSSSSAQTGS-PAAPELTHVQVNSISISSTKEQTTIS--------
A0A3Q3B0R2_BCL2-01      VASQSPTLVRRCRGARG-APGGAGTAPPDAESDPDPVLCG-R--------
A0A3Q2PN77_BCL2-01      LGDRSPTLVRRCRDAAAPGQ----------DSDGDPRRVRGR--------
A0A1X9JZA1_BCL2-01      IVAPPPSLVRRCRGAST-GP----------DSESIPHLCT-R--------
A0A3Q0S5Z7_BCL2-01      INDPPPTLVRRCREPSN-GP----------DGESNTHLCR-R--------
A0A3P8QVM8_BCL2-01      ITDPPPTLVHRCREAST-GP----------DGESNTHLCR-R--------
A0A3P9DIG5_BCL2-01      ITDPPPTLVHRCREAST-GP----------DGESNTHLCR-R--------
A0A3Q2UYW8_BCL2-01      ITDPPPTLVHRCREAST-GP----------DGESNTHLCR-R--------
A0A3B4G3K4_BCL2-01      ITDPPPTLVHRCREAST-GP----------DGESNTHLCR-R--------
A0A3Q1I5N1_BCL2-01      AVPPPPTLVRRCREAST-GP----------DSDSIPQHCR-R--------
A0A3Q3K1K1_BCL2-01      IVAPPPTLVRRCREAST-GP----------DSESTPHRCK-R--------
A0A3Q3MEY1_BCL2-01      VVAPPPTVVRRCRDAST-GP----------DSESIPQLCR-G--------
A0A3Q1FLK7_BCL2-01      VVDPPPTLVRRCHEAST-GP----------DNESDPHLCR-R--------
A0A3Q1B8C3_BCL2-01      VVDPPPTLVRRCHEAST-GP----------DNESDPHLCR-R--------
A0A3P8S9L3_BCL2-01      VVDPPPTLVRRCHEAST-GP----------DNESDPHLCR-R--------
A0A3B5BBQ0_BCL2-01      VVDPPPTLVRRCHEAST-GP----------DNESDPHLCR-R--------
A0A3B4TX71_BCL2-01      IVAPPPTLVRRCREANT-GP----------DNDSSPNLCR-R--------
A0A3B4YAG2_BCL2-01      IVAPPPTLVRRCREANT-GP----------DNDSSPNLCR-R--------
A0A286XUI2_BCL2A1-      PQCETS--------------------------------------------
Q564A4_BCL2-01          ----------QSSAEEDDTFNKAVEESSPNSDRRLQAPSAGG--------
W5N4F7_BCL2-01          ----------RVSGETDPPNNGLVGPSASGPGLQARRLQAAG--------
A0A3Q4MN81_BCL2L10      LVLAEDYLSFCCTSPHQAP-------------------------------
A0A3B4ETX9_BCL2L10      LVLAEDYLSFCCTSPHQAP-------------------------------
D2IT42_BCL2L10-02       LALSEDYLLSCTASTGTAP-------------------------------
A0A3Q0S9R1_BCL2L10      LGLAEDYLSLCCTSPHQVP-------------------------------
I3J363_BCL2L10-01       LLLAEDYLSFCCTSPHQAP-------------------------------
A0A3Q2UUP0_BCL2L10      LVLAEDYLSFCCTSPHQAP-------------------------------
A0A3P8PVZ8_BCL2L10      LVLAEDYLSFCCTSPHQAP-------------------------------
A0A3Q2UUP0_BCL2L10      LVLAEDYLSFCCTSPHQAP-------------------------------
A0A3P9BLI0_BCL2L10      LVLAEDYLSFCCTSPHQAP-------------------------------
A0A3Q2PJS5_BCL2L10      VAVAEDYMRLRCSSPHPAP-------------------------------
A0A3Q2GL87_BCL2L10      VAVAEDYMRLRCSSPLPAP-------------------------------
A0A3B5MJ12_BCL2L10      VVVAEDYIRLRCSSPHPAP-------------------------------
M4AUW7_BCL2L10-01       VVVAEDYIRLRCSSPHPAP-------------------------------
A0A096ME02_BCL2L10      VAVAEDYIHLRCSSPHPAP-------------------------------
A0A3B3TYN4_BCL2L10      VAVAEDYIRLCCSSPHPAP-------------------------------
A0A3B3YT99_BCL2L10      VAVAEDYIHLRCSSPHPAP-------------------------------
A0A3P9NE65_BCL2L10      VAVAEDYIHLRCSNPHPAP-------------------------------
A0A3P9LM07_BCL2L10      LAVALDYLSLSCRSPLQAP-------------------------------
H2MBQ3_BCL2L10-01       LAVALDYLSLSCRSPLQAP-------------------------------
A0A3B4AAV4_BCL2L10      LALAEDYLSLCCSGPQAAP-------------------------------
A0A3Q3EZU5_BCL2L10      LALAEDYLSLCCTSPRPAP-------------------------------
A0A3Q3EZU5_BCL2L10      LALAEDYLSLCCTSPRPAP-------------------------------
A0A3Q3JQ78_BCL2L10      LALAEDYLSLCCTSSRPAP-------------------------------
A0A3B4TIY6_BCL2L10      RAVAEDYLYLCCTSPQPAP-------------------------------
A0A3B4WGF4_BCL2L10      RAVAEDYLFLCCTSPQPAP-------------------------------
A0A3Q3KZW1_BCL2L10      LALAEDYLSLCCTSPQSVP-------------------------------
A0A3B5KD08_BCL2L10      LALAEDYLSLCSTSQCPAP-------------------------------
A0A3Q3VI28_BCL2L10      LALAQDYLSLCCTSQRPAP-------------------------------
A0A3Q1GM98_BCL2L10      VVLAEDYLSLCCAGPHQAP-------------------------------
A0A3Q1D2L0_BCL2L10      LVLAEDYLSLCCASPHQAP-------------------------------
A0A3P8RL82_BCL2L10      LVLAEDYLSLCCASPHQAP-------------------------------
A0A3B4ZFS0_BCL2L10      LVVAEDYLSLCCTSPHSAP-------------------------------
A0A3B4AFB7_MCL1-01      REEDYENSEGSLPCTPEFHSDSEMELSSYSAEHEVLESDTRQ--------
B9ZYL7_BCL2-01          PQASAAISNYSDDGEMPAASADSRGPPQSSLASAASSDEETP--------
A0A452I9V7_BCL2-01      RG----------PVSPNLSPPTVTGTSSDHAGLMSLPPEPPG--------
H9GPE7_BCL2-01          ------------SGDRGKSASLSPELLNSDPVSTNAPREEPD--------
A0A3Q2HRY3_BCL2-02      ------------AGAAPLGATPVPGIFSSQPGRTPAPA------------
K7F5Y4_BCL2-02          R-----------GPVSSSLSPPAAGTPSDHAGLVSLPPEPPG--------
K7F5Y4_BCL2-01          R-----------GPVSSSLSPPAAGTPSDHAGLVSLPPEPPG--------
F6YNL8_BCL2-01          RAPASP------SLPPVVASAPAVGIFSTQPRNTPLPAEPQD--------
H0YUX3_BCL2-01          RASLPPDHSASAAAAIAAAAIAAAGTSDHTGLVSPHPEPPGS--------
H0W1T3_BCL2-01          ------------GSAL---------------GRNSPLGVPRD--------
J9NXG3_BCL2-02          ------------AGAAPPGAAPAPGI------------------------
G1LID1_BCL2-02          ------------AAPA----------------------------------
I3MVK9_BCL2-01          ------------VGAASPGAAPGPGIFSSQPGS-------HT--------
G1TW27_BCL2-01          ------------A-----GAASAPGVFSSQP----APAAPRD--------
P10417_BCL2-02          ------------ADAAPLGAAPTPGIFSFQPESNPMPAVHRD--------
A0A096MPU7_BCL2-01      -------------GAATPGAAPAPGIFSSQPGHTPHPAASRD--------
P10417_BCL2-01          ------------ADAAPLGAAPTPGIFSFQPESNPMPAVHRD--------
Q7TSN8_BCL2-01          ------------ADAAPLGAAPTPGIFSFQPESNPMPAVHRD--------
Q6R755_BCL2-01          ------------VDAAPLGAAPTPGIFSFQPESNPTPAVHRD--------
Q9JJV8_BCL2-01          ------------VDAAPLGAAPTPGIFSFQPESNPTPAVHRD--------
Q923R6_BCL2-01          ------------VDAAPLGAAPTPGIFSFQPESNPTPAVHRD--------
F1LNV0_BCL2-01          ------------EDSAPLRAAPTPGIFSFQPESNRTPAVHRD--------
P49950_BCL2-01          ------------EDSAPLRAAPTPGIFSFQPESNRTPAVHRD--------
H2NWH5_BCL2-01          ------------VGAAPPGAATAPGIFSSQPGHTPHPAASRD--------
A0A3Q2HRY3_BCL2-01      ------------AGAAPLGATPVPGIFSSQPGRTPAPA------------
A0A2K6G3I7_BCL2-01      ------------AGAAPPGAAPTPGIFSSQPGRNPPPAAPRD--------
A0A287APJ6_BCL2-03      ------------AGAASPGAAPAPGIFSSQPGRTPAPA------------
H0WKI0_BCL2-01          ------------VGVAPPGAATAPGVFSSQPGRTPTPAAPRD--------
A0A2K5UDI5_BCL2-01      ------------VGAATPGAAPAPGIFSSQPGHTPHPAASRD--------
A0A2K5EB04_BCL2-01      ------------VGAAPPGAAPAPGIFSSQPGHTPGPAAPRD--------
A0A2R8MY14_BCL2-01      ------------VGAAPPGAAPAEGIFSSQPGHTPGPAAPRD--------
Q568V1_MCL1-01          LDGYIE----EEEAPLKRLRPGTNGLKGLQLDGRFVSTTDGS--------
Q1L8X3_MCL1-01          LDGYIE----EEEAPLKRLRPGTNGLKGLQLDGRFVSATDGS--------
Q9I9N3_MCL1-01          LDGYTE----EEEAPLKRLRPGTNGLKGLQLDGRFVSATDGS--------
A0A3B3ICL7_BCL2L1-      PTDDGG----ETEEDH---------------SDA----RNRR--------
A0A3B3E2W4_BCL2L1-      PTDDGG----QTAEDR---------------SAT----CNGT--------
A0A3B5B4X7_BCL2L1-      PEDAAG----RTEGDKTN-------------SAA----SNGL--------
A0A3B4BFZ8_BCL2L1-      SDPARV----QCEGNKAA-------------NVP-----NGM--------
A0A3Q3FUB6_BCL2L1-      SEDAGE----RTEGDMEN-------------SAA----SNGF--------
A0A3B5MGS2_BCL2L1-      SEVAGG----RTNWEGDS-------------RVP----RNGP--------
M4A558_BCL2L1-01        SEVAGG----RTNWEGDS-------------RVP----SNGR--------
A0A3P9QFB3_BCL2L1-      SEADGA----RTNWDGDS-------------RGP----SNGP--------
A0A087YBW4_BCL2L1-      SEADGA----RTNWDGDS-------------RGP----SNGP--------
A0A3B3VWI7_BCL2L1-      SEADGA----RTNWDGDS-------------RGP----SNGP--------
A0A3B3XN57_BCL2L1-      SEADGA----RTNWDGDS-------------RGP----SNGP--------
A0A3Q2C6K4_BCL2L1-      SEVTGG----RTEGDKDA-------------SAS----SNGP--------
A0A3Q2NRP4_BCL2L1-      SEVAGD----RTEGDKDS-------------PAS----SNGP--------
A0A0B4KJI5_BCL2L1-      PDDAGG----RTEADKAN-------------SAA----TNGL--------
A0A3Q1JZ46_BCL2L1-      PDDTGG------VGDRPN-------------SAA----ANGL--------
A0A3Q1JZ46_BCL2L1-      PDDTGG------VGDRPN-------------SAA----ANGL--------
A0A3Q3NFM4_BCL2L1-      PEDAGG----RTEGDMTG-------------AAA----TNGL--------
A0A3Q3NFM4_BCL2L1-      PEDAGG----RTEGDMTG-------------AAA----TNGL--------
A0A3B4V9K8_BCL2L1-      PEDAGG----RTEGDKAN-------------SAA----SNGL--------
A0A3B4XS24_BCL2L1-      PEDAGG----RTEGDKAS-------------SAA----SNGL--------
C1BLI0_BCL2L1-01        LEDASE----RTNVDKTN-------------VSP----VNGS--------
C0HAD8_BCL2L1-01        LEGASG----RTEGDD----------------AI----ANGS--------
A0A3B3ZN55_BCL2L1-      -------------GTEIDTERDRDL------LGL----GDRS--------
A0A3B5K6B9_BCL2L1-      ILEPPS----RTDGQFV--------------TTQ----FNGT--------
A0A3B5K6B9_BCL2L1-      ILEPPS----RTDGQFV--------------TTQ----FNGT--------
H3CH49_BCL2L1-01        IVEPSS----RTEGQFG--------------TTQ----SNGT--------
A0A3B3TFR4_BCL2L1-      QDEADE----QTGGGEGEAAGA---------VAH----ANGS--------
A0A3Q2FR43_BCL2L1-      LNEPPN----GTGAQGAEQDDERTP------ETH----ANGT--------
A0A3P8XYL5_BCL2L1-      LTGAFD----RTEGGEVEEVAAV--------TMH----PNGT--------
Q90Z98_BCL2L1-02        LTEDTN----RTDGAEENGEGAAGA------TTL----VNGT--------
Q90Z98_BCL2L1-01        LTEDTN----RTDGAEENGEGAAGA------TTL----VNGT--------
A0A059PJI5_BCL2L1-      LTEEVN--------GQVAEENAVGAGESETPTAV----VNGT--------
A0A3B4DTL9_BCL2L1-      LMEDTN----RTEGGQAAEENAEGA--AVTPTAV----VNGS--------
B5XAY3_BCL2L1-01        LTEAQN----RTEVGQVE--GGAAV------LTY----VNGT--------
W5MG74_BCL2L1-01        LE---G----RTGGAEAVGSGSPNA------EER----TNGA--------
A0A3Q3B3X5_BCL2L1-      LSDPPN----RTDAGDAGLEDAEMT------ETH----ANGT--------
A0A3B3IB64_BCL2L1-      LNESPN----RTAAGEVG--EEQST------ETH----ANGT--------
A0A3P9JYH1_BCL2L1-      LNESPN----RTAAGEVG--EEQST------ETH----ANGT--------
A0A3B3DHA1_BCL2L1-      LNESPN----RTAAGEVG--EEQST------ETH----ANGT--------
A0A3Q0RTF8_BCL2L1-      LNEPSN----RTDGGAAGLDEEQRI------DTH----ANGT--------
I3IZK7_BCL2L1-01        LNEPLN----RTDGGAAGLDEEQRI------DTH----ANGT--------
A0A2U9BY16_BCL2L1-      LNEPPN----RTDRGEAGLGEEQQT------APH----ANGT--------
A0A0D6DR75_BCL2L1-      LSEPPN----RTDGGEVESAEEQRI------ATH----ANGT--------
A0A3Q3WIW8_BCL2L1-      LIEPPN----RTEGGQAVSDEEQRV------ATH----ANGT--------
A0A219P0Y3_BCL2L1-      LIEPPN----RTDGGEAGLGEEQRV------ATH----ANGT--------
A0A3Q3MX20_BCL2L1-      LNEQQN----RTDGGEAESGEEQRI------ATH----ANGT--------
A0A3Q3G2E1_BCL2L1-      LLEPPN----RTDGAGAGSGEEQQV------ATH----ANGT--------
A0A3Q3G2E1_BCL2L1-      LLEPPN----RTDGAGAGSGEEQQV------ATH----ANGT--------
A0A3Q3G2E1_BCL2L1-      LLEPPN----RTDGAGAGSGEEQQV------ATH----ANGT--------
A0A3Q1GZ93_BCL2L1-      LNETPN----RTDGGEDGLSEEQRI------ATH----ANGT--------
A0A3Q1GZ93_BCL2L1-      LNETPN----RTDGGEDGLSEEQRI------ATH----ANGT--------
A0A3Q1GZ93_BCL2L1-      LNETPN----RTDGGEDGLSEEQRI------ATH----ANGT--------
A0A3B4V3T1_BCL2L1-      LNESPN----RTDGGEAGLVEEQRI------ATH----ANGT--------
A0A3B4XU17_BCL2L1-      LNESPN----RTDGGEAGLVEEQRI------ATH----ANGT--------
A0A3B3QRZ2_BCL2L1-      LPEDRG----RTEGSGQADGREGVM----VTATH----VNGS--------
A0A3B3ZN55_BCL2L1-      LGDRST----QSDTEHLGLGDRGVDRARLQRETE----VDST--------
G3NJY1_BCL2L1-01        LSEPPN----RTGG-----GVEAGAAGGQRGATH----SNGT--------
A0A3Q3DUT7_BCL2L1-      LRQALN----RTDG-----REEASGEEEQRVQTP----ANGT--------
A0A3Q3DUT7_BCL2L1-      LRQALN----RTDG-----REEASGEEEQRVQTP----ANGT--------
A0A3Q3DUT7_BCL2L1-      LRQALN----RTDG-----REEASGEEEQRVQTP----ANGT--------
A0A3B1JJ42_BCL2L1-      LMEETN----RTEG-----GQEAEG-NAEAAGVTPTAVVNGS--------
A0A3P8UWG7_BCL2L1-      LGDSPN----RTDG-----EEAGLG-AEQRTSTH----ANGT--------
A0A3Q3IVF5_BCL2L1-      LNESPN----RTDG-----EEA----------TH----ANGT--------
A0A3Q1DHJ3_BCL2L1-      LNEAPS----RTDG-----GEARLG-EEQRTETH----ANGT--------
A0A3Q1DHJ3_BCL2L1-      LNEAPS----RTDG-----GEARLG-EEQRTETH----ANGT--------
A0A3Q1DHJ3_BCL2L1-      LNEAPS----RTDG-----GEARLG-EEQRTETH----ANGT--------
A0A3P8TL99_BCL2L1-      LNEAPS----RTDG-----GEARLG-EEQRTETH----ANGT--------
A0A3P8TL99_BCL2L1-      LNEAPS----RTDG-----GEARLG-EEQRTETH----ANGT--------
A0A3Q1GS47_BCL2L1-      LNEAPN----RTDG-----GEARLG-EDQRTETH----ANGT--------
A0A3B4Z3X2_BCL2L1-      LNEAPN----RTDG-----GEARLA-EEQRTETH----ANGT--------
A0A3B4Z3X2_BCL2L1-      LNEAPN----RTDG-----GEARLA-EEQRTETH----ANGT--------
C3VIT1_BCL2L1-01        LNEPPN----RTGA-----GDGGLG-EEQSTETH----ANGT--------
A0A3P8P0F1_BCL2L1-      LNEPSN----RTDG-----GAAGLD-EEQRIDTH----ANGT--------
A0A3Q2X557_BCL2L1-      LNEPSN----RTDG-----GAAGLD-EEQRIDTH----ANGT--------
A0A3P9D632_BCL2L1-      LNEPSN----RTDG-----GAAGLD-EEQRIDTH----ANGT--------
A0A3P9D632_BCL2L1-      LNEPSN----RTDG-----GAAGLD-EEQRIDTH----ANGT--------
A0A3Q4N4B5_BCL2L1-      LNEPSN----RTDG-----GAAGLD-EEQRIDTH----ANGT--------
A0A3B4FNX1_BCL2L1-      LNEPSN----RTDG-----GAAGLD-EEQRIDTH----ANGT--------
A0A3Q2QPL9_BCL2L1-      LNEPPS----DGGA-----RDAESD-EEQTAETH----ANGT--------
A0A3B5PQJ0_BCL2L1-      PNEPPD----GTAA-----GDVGMD-DEQTLETH----ANGT--------
A0A087X9B7_BCL2L1-      PNEPPDSTAAGDAA-----GDAGMD-DEQTLETH----ANGT--------
A0A3B3TUS7_BCL2L1-      PNEPPDSTAAGDAA-----GDAGMD-DEQTLETH----ANGT--------
A0A3B3WI27_BCL2L1-      PNEPPDSTAAGDAA-----GDAGMD-DEQTLETH----ANGT--------
A0A3P9N9Y4_BCL2L1-      PNEPPDSTAARDAA-----GDGGMD-DEQTLETH----ANGT--------
A0A3Q3BEB7_BCL2L1-      PEVAGE----RTE--------------KASSAPSNGLLVNSR--------
A0A3P8VMA1_BCL2L1-      LRIGGE----QREG------------EEVTTASSNGVPQTPS--------
A0A345BSW9_BCL2L1-      LTEDTN----RTDG------------AEENGEGAAGTTTLVN--------
A0A286MU87_BCL2L1-      LEGASG----RTDG------------DEAIANGSVGNYR--N--------
A0A3P8XFS0_BCL2L1-      LEGASG----RTEG------------EEATANGSVGNGR--N--------
A0A3P8XFS0_BCL2L1-      LEGASG----RTEG------------EEATANGSVGNGR--N--------
A0A0F7L1T6_BCL2L1-      PEDTDG----RTEG------------EKRSPAASNGLLVRSR--------
H2U5I3_BCL2L1-01        PEDTDG----RTEG------------EKRSPGASNGLLVRSR--------
H2U5I3_BCL2L1-02        PEDTDG----RTEG------------EKRSPGASNGLLVRSR--------
A0A3Q3J5K3_BCL2L1-      PENAGG----RTEG------------DRTNPATTNGLG------------
A0A3Q1EVP6_BCL2L1-      PEDAGG----RTDG------------DKASSASSNGLLVN----------
A0A3Q1BQA0_BCL2L1-      PEDAGG----RTDG------------DKANSASSNGLLVN----------
A0A3P8U812_BCL2L1-      PEDAEG----RTDG------------DKANSASSNGLLVN----------
E6ZFR0_BCL2L1-01        PENAGE----RTEG------------DKANSAARNGLLASKN--------
G3P7B4_BCL2L1-01        PEDAGG----RTEG------------DKANSASVPGRGSSAG--------
A0A3Q3X5M5_BCL2L1-      PEDTGG----RTEG------------DKASSAARNGLLVNSS--------
A0A2U9BIG9_BCL2L1-      PEDAGG----RTEG------------DKANSAASNGLLVDGG--------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q2Y539_MCL1-01      MDE----------GAQPLP-------------------------------
H3AR18_MCL1-02          -------------GYNADG-------SVPPSPPTPSTPEDGD--------
A0A3B1K5R1_MCL1-01      GGGGGAGLSLGLAADIRPT--------RPGVDDGSVPSSPLS--------
A0A3B4C6H5_MCL1-01      ------LFSFVWEFSRKWPWNFLWEKLIAAVTDGSLPTSPAS--------
A0A3B4C6H5_MCL1-02      -----RPFTLGISSQTRAP-------RIAAVTDGSLPTSPAS--------
A0A3B4C6H5_MCL1-03      -----RPFTLGISSQTRAP-------RIAAVTDGSLPTSPAS--------
A0A3Q1IAB0_BCL2L10      DKCADAEGKLRVHRGSPSA-------VRMCREQTDIAGRKMS--------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
A0A3P8WUE9_BCL2-01      DRDG---------DAANNG-------SIVSRPPTLV-HRCRG--------
A0A3Q3G1D7_BCL2-01      EQDE---------DAANNG-------SLVAPPPTLV-RRCRE--------
A0A3B4A3G8_BCL2-01      DAEDEG-------DVANNG-------SIVASSPVLVNRRCRA--------
D2ITA2_BCL2L1-02        EGAGEGTDEDKSNRIGNNG-------LRLNDGNGNGQLAP----------
A0A452FIG6_BCL2L1-      DKIRYG-------NPNAVN-------ANPSWHLAHSPAVNGA--------
A0A452FIG6_BCL2L1-      DKIRYG-------NPNAVN-------ANPSWHLAHSPAVNGA--------
Q8UWD6_MCL1-01          QFAVDS-------LQGSVP-------SSPSDETGDYPPTALD--------
F8W4Q8_MCL1-01          QFAVDS-------LQGSVP-------SSPSDETGDYPPTALD--------
Q568W5_MCL1-01          QFAVDS-------LQGSVP-------SSPSDETGDYPPTALD--------
M3Y8D1_BCL2L10-01       RERTAQLLTDYLEYCARGP-------GTPARSPS----------------
H3ANS8_BCL2L1-01        QDHGGGGDRAREAQTPEEG-------AIPGMDPPNGSHPHAG--------
F7G6M3_BCL2L2-01        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A3P8W7K5_BCL2L10      LSLCCS-------SPRPAP-------------------------------
A0A3B3ICL7_BCL2L1-      PTDDGGETEEDH-SDARNR-------RLVSSEDGRLRRS-----------
A0A452U2H8_BCL2A1-      -------------MHTEIP-------PASARPMSHRPSPAGA--------
A0A452U2H8_BCL2A1-      -------------MHTEIP-------PASARPMSHRPSPAGA--------
F7BXJ7_BCL2-01          QQVSA--------EHPQAS-------AAISNYSDDGEMPAAS--------
A0A3B3TCS4_BCL2-01      AGDTDSPNNGSV-DSPPGS-------QVLARRSQAAAAGGED--------
H0Z8G3_BCL2L1-01        EEDENRTDFAG--EEDEMD-------GVLNGSPSWHAATSHI--------
U3JSL7_BCL2L1-01        EEDENRTDFAG--EEDEMD-------GVLNGSPSWHAPTSHI--------
Q4U2V6_BCL2L1-01        EEDENRTDFAG--EEDEMD-------GVLNGSPSWHAATSHI--------
A0A3P8YNB4_BCL2-01      AEEEDGANNGS--MISPPP-------GLVRRIHGASKAGQGS--------
A0A3P9AAB2_BCL2-01      ENQSRNNVFEDP-SPPNSP-------ELFARRLQPPAAGEDN--------
A0A0U3DHY6_BCL2-01      ENDSPNNLFGDP-STPNTP-------EVFARRSQPTAAVEDT--------
X4ZGI8_BCL2-01          SGEDDDTINTGVEDSSP---------------------------------
U3KEW4_BCL2-01          -------------HRAPLP-------PGLSAPAAAAVAAAAG--------
Q00709_BCL2-01          -------------DRPPVP-------PAPAPAAAPAAVAAAG--------
K7F5Y4_BCL2-03          NRGPVS--------------------------------------------
G3WZW9_BCL2-01          LRTPASPSLPPVVASAPAV-------GIFSNQPRHTPLPAAP--------
A0A452R145_BCL2-02      RAPRPR-------GPPPRR-------ASSPPSLGSPPRPPGP--------
M3YYK3_BCL2-01          ---------------RPVM-------KLVYLPTAPPPPPLSR--------
P10415_BCL2-04          VGAAPP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
A0A2K6R2I6_BCL2-02      VGAATP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
J9NXG3_BCL2-01          AGAAPP-------GAAPAP-------GISASQXXXXXXXXXX--------
A0A1D5QRF2_BCL2-01      VGAATP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
A0A2R9APW6_BCL2-01      VGAAP---------------------------------------------
G3ULB7_BCL2-01          ASAAPP-------GAAPAP-------GVLSSPPAAPRGPD----------
A9QXG9_BCL2-01          VGAAPP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
A0A2K5NZS5_BCL2-01      VGAATP-------GVAPAP-------GIFSSQPGHTPHPAAS--------
A0A0D9S017_BCL2-01      VGAATP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
A0A2K6CIX3_BCL2-01      VGAATP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
A0A2K5XRD4_BCL2-01      VGAATP-------GVAPAP-------GIFSSQPGHTPHPAAS--------
A0A2K6KHG1_BCL2-01      VGAATP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
A0A2K6R2I6_BCL2-01      VGAATP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
A0A2K5HK49_BCL2-01      VGAATP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
G3QES9_BCL2-01          VGAVPP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
A0A2I3GZF9_BCL2-01      VGAAPP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
A0A2K6UEL3_BCL2-01      VGAAPP-------GAAPAP-------GIFSSQPGHTPGPAAP--------
P10415_BCL2-01          VGAAPP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
P10415_BCL2-02          VGAAPP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
H2QEM8_BCL2-01          VGAAPP-------GAAPAP-------GIFSSQPGHTPHPAAS--------
A0A2U4BHU7_BCL2-01      AGATSP-------GAAPAP-------GIFSSQPGSTPAP-----------
Q75SV7_BCL2-01          AGAAPP-------GAAPAP-------GIFSSQPGRAPAP-----------
M3X1R9_BCL2-01          AGAAPP-------GAAPAP-------GIFSSQPGRTPAP-----------
A0A076FU27_BCL2-01      AGAAPP-------GAAPAP-------GILSSQPGRTPAP-----------
F6R2C4_BCL2-01          AGAAPP-------GAAPAP-------GILSSQPGRTPAP-----------
O02718_BCL2-01          AGAAPP-------GAAPAP-------GILSSQPGRTPAP-----------
A0A076FZV9_BCL2-01      AGAAPP-------GAAPAP-------GILSSQPGRTPAP-----------
A0A452EV13_BCL2-01      AGAAPP-------GAAPAP-------GILSSQPGRAPAP-----------
G1LID1_BCL2-01          ------------------------------PHPAASPRPFVR--------
A0A452R145_BCL2-01      RAPRPR-------GPPPRR-------ASSPPSLGSPPRPPGP--------
G3WZW9_BCL2-02          ------------------V-------------------------------
G3ULB7_BCL2-02          ADTRTS-------PLQADP-------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
G3PJT0_MCL1-01          -MRQLAMGSAKDSHNGNAG-----TNDTPKRPSALGVNSANG-YPSKPQR
A0A3Q3VP02_MCL1-01      -SSQIGMGSCLDSHNGNVA-----LNDTSKRPNLLVVNPTKE-YMGKPIR
A0A3B5K5B3_MCL1-01      -SSPL----IPMASRGSLS-----GNDSPKRPSKLSVIAPKV-CVAKAIQ
H2MLZ3_MCL1-01          MSARVPLPSTLASHVANPD-----PSDQLKRPQDLE-------YSARRF-
H2MLZ3_MCL1-02          MSARVPLPSTLASHVANPD-----PSDQLKRPQDLE-------YSARRF-
A0A3B3CEX1_MCL1-02      RSARVPLTSATASRGANPD-----PSEQMKRPQDLDMLGNKSPYAARRF-
A0A3B3CEX1_MCL1-01      RSARVPLTSATASRGANPD-----PSEQMKRPQDLDMLGNKSPYAARRF-
A0A3Q3B4V7_MCL1-01      TSPQVSIGASLGSENGSVA-----SCNSSKRPKDLVMPPLKG-YQDKRFQ
A0A3Q3B4V7_MCL1-02      TSPQVSIGASLGSENGSVA-----SCNSSKRPKDLVMPPLKG-YQDKRFQ
A0A3Q2EDX8_MCL1-01      AAPEIPMNSPMGSLHRN----------LMKRPKDLQV-ATNG-YVGKNLS
A0A3Q2T2A9_MCL1-02      QLPEVEMSSSSEDLRWD-------CS---KRPKNLRVMARNG-FAVKSIQ
A0A3Q2T2A9_MCL1-01      QLPEVEMSSSSEDLRWD-------CS---KRPKNLRVMARNG-FAVKSIQ
A0A3B5PQ55_MCL1-02      GVPEVAMGSTVESLHSP-------KDPFMKRPTNLGV---NG-YVAKSLP
A0A3B5PQ55_MCL1-01      GVPEVAMGSTVESLHSP-------KDPFMKRPTNLGV---NG-YVAKSLP
A0A3P9Q4R7_MCL1-02      VVPEVAMGSRVESLHSP-------MDPFKKRPTNLAVTASNG-YVAKSLP
A0A3P9Q4R7_MCL1-01      VVPEVAMGSRVESLHSP-------MDPFKKRPTNLAVTASNG-YVAKSLP
A0A087X830_MCL1-01      VVPEVAMGATVDSLHSP-------KDPYKKRPTNLAVSASNG-YVAKSLQ
A0A3B3YCD0_MCL1-01      VVPEVAMGATVDSLHSP-------KDPYKQRPTNLAVTASNG-YVAKSLQ
A0A3P8VKS9_MCL1-02      STPIALASSLSTHNDSMSS-----VTETQRRPKDLQVNTANG-HARKS--
A0A3P8VKS9_MCL1-01      STPIALASSLSTHNDSMSS-----VTETQRRPKDLQVNTANG-HARKS--
A0A3P8VKS9_MCL1-05      STPIALASSLSTHNDSMSS-----VTETQRRPKDLQVNTANG-HARKS--
A0A3P8VKS9_MCL1-04      STPIALASSLSTHNDSMSS-----VTETQRRPKDLQVNTANG-HARKS--
A0A3P8VKS9_MCL1-03      STPIALASSLSTHNDSMSS-----VTETQRRPKDLQVNTANG-HARKS--
I3JHR5_MCL1-01          SSPQNATGSSKDSSNGI-V-----SNGTPKRPNNLGVTSTNG-YTTKAI-
A0A3Q4HLQ8_MCL1-01      SSPQNATGSSKDSSNGI-V-----SNGTPKRPDNLEVTSTNG-YTTKAI-
A0A3P8NP63_MCL1-02      SSPQNATGSSKDSSNGI-V-----SNGTPKRPDNLEVTSTNG-YKTKAI-
A0A3P8NP63_MCL1-03      SSPQNATGSSKDSSNGI-V-----SNGTPKRPDNLEVTSTNG-YKTKAI-
A0A3Q2VNL8_MCL1-01      SSPQNATGSSKDSSNGI-V-----SNGTPKRPDNLEVTSTNG-YKTKAI-
A0A3P8NP63_MCL1-01      SSPQNATGSSKDSSNGI-V-----SNGTPKRPDNLEVTSTNG-YKTKAI-
A0A3P9BVM3_MCL1-01      SSPQNATGSSKDSSNGI-V-----SNGTPKRPDNLEVTSTNG-YKTKAI-
A0A3B4G4Z6_MCL1-01      SSPQNATGSSKDSSNGI-V-----SNGTPKRPDNLEVTSTNG-YKTKAI-
A0A2U9CJ81_MCL1-01      SLPQIAVGSVIDSRGGNVG-----AGDAPKRPKNLQVSATKA-YAAKSCR
A0A3Q3IZW0_MCL1-01      TSPQFAVGSSIDSCKGNVG-----PNNTLKRPKILDVSSTNG-YGTKTL-
A0A3Q1GX28_MCL1-02      NSPQITMSSSIDACNGN---------AALKRPKNLDVSSSNG-YATKNIG
A0A3Q1GX28_MCL1-01      NSPQITMSSSIDACNGN---------AALKRPKNLDVSSSNG-YATKNIG
A0A3B4XKA5_MCL1-01      SSPEIAIGSTLCCDNGNVV-----PNDNSKRPKSLEVTSTNG-YATKASR
A0A3Q3GP42_MCL1-01      SSPQIAMGSSLASQNGNVG-----SNETTKRPKALVVNSGN---------
A0A3Q3M6G2_MCL1-02      PSTQF----TLDSRNGN-G-----GTANPKRPKNLEVSSTNG-YATKSIV
A0A3Q3M6G2_MCL1-01      PSTQF----TLDSRNGN-G-----GTANPKRPKNLEVSSTNG-YATKSIV
W5MMB7_MCL1-01          LDPMLKADYAEDELDNYSAEPVATSAWIPKSPRSLPAGLKLG-GHFPESG
A0A3B3R4U0_MCL1-01      SLPVAPLKAKSEEELDSLD-----EGERF-----------HG-APKTERR
A0A3B3SG34_MCL1-01      NTPCLESSGLWDDELDNCTD----EVDVCPCSTRLAKRDSEK-EPCRGSR
Q4SW32_MCL1-01          ---QIPMGSPRDAFNGN-------VGDSPKRPSKLTVVKPKV-CLSKTIQ
D2ITA0_MCL1-03          LPLMATFKS---------------GDERKPRPTELG----RG-RLVNKSQ
D2ITA0_MCL1-04          LPLMATFKS---------------GDERKPRPTELG----RG-RLVNKSQ
Q0KFR9_MCL1-01          ICAGASPKSK--VDLGNG------TGDTPPRPTTLGVNVVKS-NGLDNHL
A0A3P8Y1W8_MCL1-01      LCPAASSKSKMDVDLGNG------TADTPVRPTKLEVNMTKP-NVLDSRL
A0A3P8Y1W8_MCL1-02      LCPAASSKSKMDVDLGNG------TADTPVRPTKLEVNMTKP-NVLDSRL
A0A3Q2XZL8_MCL1-01      VAAASTSPPQLHRAVATLGAVNCNSGAAKPRPSALEILCKGG-LATMNHR
A0A3B4AFB7_MCL1-02      SSAQMPRPATMDTRKGNTA-----SSGSP-HPRPTALVMKNE-LLNKNTR
A0A3B3VM25_MCL1-01      VVPEVAMGATVDSLHSP-------KDPYKQRPTNLAVTASNG-YVAKSLQ
A0A3Q0RA11_MCL1-03      SSPQDATGTPKDS------------NGTPKRPNNLGVVSTNG-YAPKNI-
A0A3Q0RA11_MCL1-01      --------TSPDS------------NGTPKRPNNLGVVSTNG-YAPKNI-
A0A3B4T8L9_MCL1-02      SSPEIAIGSTICSHNGNVV-----PNDNSKRPKSLEVTSTNG-YATKASR
A0A3B4T8L9_MCL1-01      SSPEIAIGSTICSHNGNVV-----PNDNSKRPKSLEVTSTNG-YATKASR
A0A3Q1EQB9_MCL1-02      SSPQISVASSIDPQNGNLG-----SSDTPKRPKNLGV---NG-YAPKSLR
A0A3B4ZKP6_MCL1-01      PSAQIPMASPLDSHNGNVG-----SGATPKRPKNLGVSTTNG-FAGKGLR
A0A3Q1BKL8_MCL1-02      SSPQIAVASSIDSHNGNVG-----SNETPKRPKNLGV---NG-YASKNLR
A0A3Q1EQB9_MCL1-01      SSPQISVASSIDPQNGNLG-----SSDTPKRPKNLGV---NG-YAPKSLR
A0A3Q1BKL8_MCL1-01      SSPQIAVASSIDSHNGNVG-----SNETPKRPKNLGV---NG-YASKNLR
A0A3P8RQX7_MCL1-02      SSPQIAVASSIDSHNGNVG-----SSETPKRPKNLGV---NG-YASKNLR
A0A3P8RQX7_MCL1-01      SSPQIAVASSIDSHNGNVG-----SSETPKRPKNLGV---NG-YASKNLR
U3JTB2_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
G1T1L8_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
E2RS00_BCL2A1-01        --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-02        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-02        --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
C7F841_BCL2A1-02        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
F7ETY1_MCL1-01          --------------------------------------------------
A0A287APJ6_BCL2-01      --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
F7G4L5_BCL2L2-04        --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
W5QDH5_BCL2L2-01        --------------------------------------------------
D3Z5F7_BCL2L2-01        --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-05        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-01        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-02          --------------------------------------------------
G1QAV8_MCL1-01          --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-03          --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSC7_MCL1-03      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-02      --------------------------------------------------
F6ZMX1_MCL1-01          --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-02          --------------------------------------------------
P97287_MCL1-01          --------------------------------------------------
G3T756_MCL1-01          --------------------------------------------------
G1L3M8_MCL1-02          --------------------------------------------------
A0A2U3V2H3_MCL1-01      --------------------------------------------------
K9IWB2_MCL1-03          --------------------------------------------------
K9IWB2_MCL1-02          --------------------------------------------------
K9IWB2_MCL1-01          --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      --------------------------------------------------
A0A452GAH0_MCL1-02      --------------------------------------------------
A0A2K5I9Q7_MCL1-01      --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
J9PBC4_MCL1-01          --------------------------------------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A452GAH0_MCL1-01      --------------------------------------------------
G1L3M8_MCL1-01          --------------------------------------------------
F7AVA6_MCL1-01          --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
M3XAP4_MCL1-01          --------------------------------------------------
Q7YRZ9_MCL1-01          --------------------------------------------------
J9PBC4_MCL1-02          --------------------------------------------------
Q8HYS5_MCL1-01          --------------------------------------------------
M3XZZ5_MCL1-01          --------------------------------------------------
A0A452RHX5_MCL1-01      --------------------------------------------------
H0XFB7_MCL1-01          --------------------------------------------------
A0A2K6GI15_MCL1-02      --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5CFH3_MCL1-01      --------------------------------------------------
A0A2K6V5Y3_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K6PPL1_MCL1-01      --------------------------------------------------
A0A2K5XSC7_MCL1-01      --------------------------------------------------
A0A0D9RZP5_MCL1-01      --------------------------------------------------
A0A2K5W0W9_MCL1-02      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
F7HUE9_MCL1-01          --------------------------------------------------
A0A2K6ECR0_MCL1-01      --------------------------------------------------
A0A2I3M3D6_MCL1-02      --------------------------------------------------
A0A2K5LXU8_MCL1-01      --------------------------------------------------
A0A2I3GB35_MCL1-02      --------------------------------------------------
H2N5Y9_MCL1-01          --------------------------------------------------
Q07820_MCL1-01          --------------------------------------------------
A0A2R9BYH6_MCL1-01      --------------------------------------------------
K7DE58_MCL1-01          --------------------------------------------------
A0A2I2YQH7_MCL1-01      --------------------------------------------------
A0A2K5I9Q7_MCL1-02      --------------------------------------------------
M3XAP4_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K6V5Y3_MCL1-02      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPL1_MCL1-02      --------------------------------------------------
A0A2K5LXU8_MCL1-02      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3M3D6_MCL1-01      --------------------------------------------------
A0A2K5XSC7_MCL1-02      --------------------------------------------------
A0A2I3GB35_MCL1-01      --------------------------------------------------
Q07820_MCL1-03          --------------------------------------------------
A0A2R9BYH6_MCL1-02      --------------------------------------------------
K7DE58_MCL1-02          --------------------------------------------------
A0A2I2YQH7_MCL1-02      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
F8W4Q8_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
F6TEC3_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
F6PH48_BCL2L2-01        --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
I3ND50_BCL2L2-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-03        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
F6U940_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-02        --------------------------------------------------
W5QDH5_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
I3ND50_BCL2L2-02        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
Q6GLI5_BCL2L1-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-02        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
A0A2U3V0P1_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-01        --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-02        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
G3RY91_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-03        --------------------------------------------------
Q64373_BCL2L1-04        --------------------------------------------------
P53563_BCL2L1-04        --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------ADVDFIQDFSCRCPGALEAETRRLMVEFYRGYL-GQKP----
A0A3B4E3I4_MCL1-03      --------------------GGSALVEETRRLIGGFYRGYI-GQKT----
A0A3B4E3I4_MCL1-02      -----LCDGEVTVLIKPKPKGRVRLEEETLCIIGDFYQGY----RS----
A0A3B4E3I4_MCL1-01      -----LCDGEVTVLIKPKPKGRVRLEEETLCIIGDFYQGY----RS----
A0A3Q3B0R2_BCL2-01      -----ISPH-----------------------------------------
A0A3Q2PN77_BCL2-01      -----LSQS-----------------------------------------
A0A1X9JZA1_BCL2-01      -----LPQS-----------------------------------------
A0A3Q0S5Z7_BCL2-01      -----LPQS-----------------------------------------
A0A3P8QVM8_BCL2-01      -----LPQS-----------------------------------------
A0A3P9DIG5_BCL2-01      -----LPQS-----------------------------------------
A0A3Q2UYW8_BCL2-01      -----LPQS-----------------------------------------
A0A3B4G3K4_BCL2-01      -----LPQS-----------------------------------------
A0A3Q1I5N1_BCL2-01      -----LPPS-----------------------------------------
A0A3Q3K1K1_BCL2-01      -----PPQS-----------------------------------------
A0A3Q3MEY1_BCL2-01      -----LPQS-----------------------------------------
A0A3Q1FLK7_BCL2-01      -----LPQS-----------------------------------------
A0A3Q1B8C3_BCL2-01      -----LPQS-----------------------------------------
A0A3P8S9L3_BCL2-01      -----LPQS-----------------------------------------
A0A3B5BBQ0_BCL2-01      -----LPQS-----------------------------------------
A0A3B4TX71_BCL2-01      -----LSQS-----------------------------------------
A0A3B4YAG2_BCL2-01      -----LSQS-----------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
Q564A4_BCL2-01          -----GNNSECLIARVT-RS------------------------------
W5N4F7_BCL2-01          -----AERGAVPVPRRTPPP------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       --------------------------------------------------
A0A3Q2UUP0_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUP0_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B4AFB7_MCL1-01      -----LLSDFFKLFTGISQPK-----------------------------
B9ZYL7_BCL2-01          -----SNTPITFVGNAPAVPRRSASAVSPLAELNVEPRDLN-VNPDASRA
A0A452I9V7_BCL2-01      -----SAAASN-----------------------VPLG----------DG
H9GPE7_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------RTS--------PLLPPAAP------AGAAG----------PA
K7F5Y4_BCL2-02          -----SAAASN-----------------------VPLG----------DG
K7F5Y4_BCL2-01          -----SAAASN-----------------------VPLG----------DG
F6YNL8_BCL2-01          -----SATSTTAAARNSPLPLPPPAVA-----AAAAAG----------PT
H0YUX3_BCL2-01          -----ATASHT--------PPAE--------------------------G
H0W1T3_BCL2-01          -----PAARTS--------PPPPLAG------LAVAQG----------PA
J9NXG3_BCL2-02          -------------------------------------S----------AS
G1LID1_BCL2-02          --------------------------------AAAAAG----------PA
I3MVK9_BCL2-01          -----PAARTS--------PPPPPAAP------AAAAG----------PV
G1TW27_BCL2-01          -----PAARTS--------PPPP----------PAAAG----------PA
P10417_BCL2-02          -----MAARTS--------PLRP---------LVATAG----------PA
A0A096MPU7_BCL2-01      -----PVARTS--------PLPTPAAP------AAAAG----------PA
P10417_BCL2-01          -----MAARTS--------PLRP---------LVATAG----------PA
Q7TSN8_BCL2-01          -----MAARTS--------PLRP---------LVATAG----------PA
Q6R755_BCL2-01          -----MAARTS--------PLRP---------IVATTG----------PT
Q9JJV8_BCL2-01          -----MAARTS--------PLRP---------IVATTG----------PT
Q923R6_BCL2-01          -----MAARTS--------PLRP---------IVATTG----------PT
F1LNV0_BCL2-01          -----TAARTS--------PLRP---------LVATAG----------PA
P49950_BCL2-01          -----TAARTS--------PLRP---------LVANAG----------PA
H2NWH5_BCL2-01          -----PA-RTS--------PLPTPAAP------GAAVG----------PA
A0A3Q2HRY3_BCL2-01      --------RTS--------PLLPPAAP------AGAAG----------PA
A0A2K6G3I7_BCL2-01      -----PAARTS--------PPP-----------AAAAG----------PA
A0A287APJ6_BCL2-03      --------RTS--------PPPTPTAPAATAAAAAAAG----------PV
H0WKI0_BCL2-01          -----PAARTS--------PPAAPA-------AAAAAE----------PL
A0A2K5UDI5_BCL2-01      -----PVARTS--------PLPTPAAP---AAAAAAAG----------PA
A0A2K5EB04_BCL2-01      -----PVSRTS--------PPPPPAAP-----AAAATG----------PA
A0A2R8MY14_BCL2-01      -----PVARTS--------PPPPPAAP-----AAAATG----------PT
Q568V1_MCL1-01          -----LPT---------TPDPEELDYAELERDTRQLLLDFY-RTHTGMCP
Q1L8X3_MCL1-01          -----LPT---------TPDPEELDYAELERDTRQLLLDFY-RTHTGMCP
Q9I9N3_MCL1-01          -----LPT---------TPDPEELDYAELERDTRQLLLDFY-RTHTGMCP
A0A3B3ICL7_BCL2L1-      -----LVSS---EDGRLRRSCPCCA-------------------------
A0A3B3E2W4_BCL2L1-      -----LVNS---EDGQLKKSCPCCA-------------------------
A0A3B5B4X7_BCL2L1-      -----LVNS--------------RG-------------------------
A0A3B4BFZ8_BCL2L1-      -----LTNR-N-GNRQTLASLPPDD-------------------------
A0A3Q3FUB6_BCL2L1-      -----LVNS-RNRAGQSVMSSSPHT-------------------------
A0A3B5MGS2_BCL2L1-      -----LVNS---WAGHPGKPRGPPA-------------------------
M4A558_BCL2L1-01        -----LVNS---RAGPPGKPRGPMA-------------------------
A0A3P9QFB3_BCL2L1-      -----LVNS---RAGSRGKSQGPP--------------------------
A0A087YBW4_BCL2L1-      -----LVNS---WAGSPGKSRDPPT-------------------------
A0A3B3VWI7_BCL2L1-      -----LVNS---WAGSPGKSRDPPT-------------------------
A0A3B3XN57_BCL2L1-      -----LVNS---WAGSPGKSQDPPT-------------------------
A0A3Q2C6K4_BCL2L1-      -----LFNS---RPSPPGKPRAPHG-------------------------
A0A3Q2NRP4_BCL2L1-      -----LVSS---WAGSPWQPWAPHG-------------------------
A0A0B4KJI5_BCL2L1-      -----LANS-SNGGGQPGAD------------------------------
A0A3Q1JZ46_BCL2L1-      -----PVS----RSGELGNSSPPCK-------------------------
A0A3Q1JZ46_BCL2L1-      -----PVS----RSGELGNSSPPCK-------------------------
A0A3Q3NFM4_BCL2L1-      -----LVNS-RYVSGRPGMSSSPHG-------------------------
A0A3Q3NFM4_BCL2L1-      -----LVNS-RYVSGRPGMSSSPHG-------------------------
A0A3B4V9K8_BCL2L1-      -----LVNS-SDRCGQPGTSSPPHG-------------------------
A0A3B4XS24_BCL2L1-      -----LVNS-SDRCGQPGTSSPPHG-------------------------
C1BLI0_BCL2L1-01        -----VEND-RNCIGSLGISSSPQG-------------------------
C0HAD8_BCL2L1-01        -----VGNS-RS---NLAKPSSPQG-------------------------
A0A3B3ZN55_BCL2L1-      -----VDRN--------STPSLRLR-------------------------
A0A3B5K6B9_BCL2L1-      -----FNGA---SPG--TPPATSLA-------------------------
A0A3B5K6B9_BCL2L1-      -----FNGA---SPG--TPPATSLA-------------------------
H3CH49_BCL2L1-01        -----FNGA---SPG--TPPAPSQH-----Q-----------------QS
A0A3B3TFR4_BCL2L1-      -----VSSGNSVGQG--APLEGATP-------------------------
A0A3Q2FR43_BCL2L1-      -----FNGT---SPG--SP--------RRQQ-----------------AS
A0A3P8XYL5_BCL2L1-      -----MNGT--SPGT--PTQQSPPSSPRRTV-------------------
Q90Z98_BCL2L1-02        -----MNRTNASSTG--TPPQSPASSPQRQT-----------------NG
Q90Z98_BCL2L1-01        -----MNRTNASSTG--TPPQSPASSPQRQT-----------------NG
A0A059PJI5_BCL2L1-      -----LNGT--GSAG--TPPRSPTLSPQRQV-----------------NG
A0A3B4DTL9_BCL2L1-      -----VNGT--SHG----PAGSPTSSPQRRS-----------------NG
B5XAY3_BCL2L1-01        -----SPGT---PPPRQSPPSSPRR-------------------------
W5MG74_BCL2L1-01        -----ANGG---GGP--VSRQPPQG-------------------------
A0A3Q3B3X5_BCL2L1-      -----FNGT---SPG--TPPASPLR--QQPL-----------------PT
A0A3B3IB64_BCL2L1-      -----FNGT---TPG--TPPLSPLR--EQQL-----------------PS
A0A3P9JYH1_BCL2L1-      -----FNGT---TPG--TPPLSPLR--EQQL-----------------PS
A0A3B3DHA1_BCL2L1-      -----FNGT---SPG--TPPLSPLR--QQQL-----------------PS
A0A3Q0RTF8_BCL2L1-      -----FNGT---SPG--TPPASPQR--QQQP-----------------PS
I3IZK7_BCL2L1-01        -----FNGT---SPG--TPPASPQR--QQQP-----------------PS
A0A2U9BY16_BCL2L1-      -----LNGV---NPG--TPPESPLR--LQRL-----------------PS
A0A0D6DR75_BCL2L1-      -----FNGR---SPG--TPPASPLR--QQRL-----------------PS
A0A3Q3WIW8_BCL2L1-      -----FNGT---SPG--TPPRSPLR----LQ-----------------PS
A0A219P0Y3_BCL2L1-      -----FNGM---SPG--TPPASPLR--QQQL-----------------PS
A0A3Q3MX20_BCL2L1-      -----FNGT---SPG--TPPASPLR--QEHL-----------------QS
A0A3Q3G2E1_BCL2L1-      -----FNGT---SPG--TPPASPHRQQQQRL-----------------PA
A0A3Q3G2E1_BCL2L1-      -----FNGT---SPG--TPPASPHRQQQQRL-----------------PA
A0A3Q3G2E1_BCL2L1-      -----FNGT---SPG--TPPASPHRQQQQRL-----------------PA
A0A3Q1GZ93_BCL2L1-      -----FNGR---SPG--TPPASPLR--QQRL-----------------PS
A0A3Q1GZ93_BCL2L1-      -----FNGR---SPG--TPPASPLR--QQRL-----------------PS
A0A3Q1GZ93_BCL2L1-      -----FNGR---SPG--TPPASPLR--QQRL-----------------PS
A0A3B4V3T1_BCL2L1-      -----FNGT---SPG--TRAESPQR--QQRL-----------------PS
A0A3B4XU17_BCL2L1-      -----FNGT---SPG--TRPESPQR--QQRL-----------------PS
A0A3B3QRZ2_BCL2L1-      -----VIAGGTSSQV--SPVPEQPLHSPSPS-----------------PQ
A0A3B3ZN55_BCL2L1-      -----ELRLDSASDS--APVHSPAPLLD----------------------
G3NJY1_BCL2L1-01        -----FNGTS---PG--TPPASPLLQQRSPS-----------------TA
A0A3Q3DUT7_BCL2L1-      -----TNGTS--------PPASPLREAAS---------------------
A0A3Q3DUT7_BCL2L1-      -----TNGTS--------PPASPLREAAS---------------------
A0A3Q3DUT7_BCL2L1-      -----TNGTS--------PPASPLREAAS---------------------
A0A3B1JJ42_BCL2L1-      -----VNGTSHGAAG--SPTSSPQRRANGAR-----------------G-
A0A3P8UWG7_BCL2L1-      -----VNGTS---SG--TPPASPLRQQHSAS-----------------DT
A0A3Q3IVF5_BCL2L1-      -----FNGTS---PG--TPPASPLRQQQLPS-----------------TA
A0A3Q1DHJ3_BCL2L1-      -----FNGTS---PG--TPPPSPRRLASTAT-------------------
A0A3Q1DHJ3_BCL2L1-      -----FNGTS---PG--TPPPSPRRLASTAT-------------------
A0A3Q1DHJ3_BCL2L1-      -----FNGTS---PG--TPPPSPRRLASTAT-------------------
A0A3P8TL99_BCL2L1-      -----FNGTS---PG--TPPPSPRRLASTAT-------------------
A0A3P8TL99_BCL2L1-      -----FNGTS---PG--TPPPSPRRLASTAT-------------------
A0A3Q1GS47_BCL2L1-      -----FNGTS---PG--TPPPSPRRLASTAT-------------------
A0A3B4Z3X2_BCL2L1-      -----FNGTS---PG--TPPPSPRRLASTAT-------------------
A0A3B4Z3X2_BCL2L1-      -----FNGTS---PG--TPPPSPRRLASTAT-------------------
C3VIT1_BCL2L1-01        -----FTGTS---PG--TPPVSPLRQQPLPS-----------------TT
A0A3P8P0F1_BCL2L1-      -----FNGTS---PG--TPPASPQRRQQQPP-----------------ST
A0A3Q2X557_BCL2L1-      -----FNGTS---PG--TPPASPQRRQQQPP-----------------ST
A0A3P9D632_BCL2L1-      -----FNGTS---PG--TPPASPQRRQQQPP-----------------ST
A0A3P9D632_BCL2L1-      -----FNGTS---PG--TPPASPQRRQQQPP-----------------ST
A0A3Q4N4B5_BCL2L1-      -----FNGTS---PG--TPPASPQRRQQQPP-----------------ST
A0A3B4FNX1_BCL2L1-      -----FNGTS---PG--TPPASPQRRQQQPP-----------------ST
A0A3Q2QPL9_BCL2L1-      -----VNGTS---SG--SPRRRQQQPASTAA-------------------
A0A3B5PQJ0_BCL2L1-      -----FNGTS---PG--SPRR--HQAASAST-------------------
A0A087X9B7_BCL2L1-      -----FNGTS---PG--SPRR--QQAASAAT-------------------
A0A3B3TUS7_BCL2L1-      -----FNGTS---PG--SPRR--QQAASAAT-------------------
A0A3B3WI27_BCL2L1-      -----FNGTS---PG--SPRR--QQAASAAT-------------------
A0A3P9N9Y4_BCL2L1-      -----FNGTS---PG--SPRR--QQAASAST-------------------
A0A3Q3BEB7_BCL2L1-      -----DGQS----------------GKKIWP-----------------RR
A0A3P8VMA1_BCL2L1-      -----AVLQ---------------------------------------HC
A0A345BSW9_BCL2L1-      -----GSMN----RT--PPQSPATSPQHQTN-----------------GS
A0A286MU87_BCL2L1-      -----SRSN----LA--KPSSP---------------------------Q
A0A3P8XFS0_BCL2L1-      -----SRRN----LG--KPSTP---------------------------Q
A0A3P8XFS0_BCL2L1-      -----SRRN----LG--KPSTP---------------------------Q
A0A0F7L1T6_BCL2L1-      -----NRGG--------ASPSA---------------------------G
H2U5I3_BCL2L1-01        -----NRGG--------ASPSA---------------------------G
H2U5I3_BCL2L1-02        -----NRGG--------ASPSA---------------------------G
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      -----NRDG-----------------------------------------
A0A3Q1BQA0_BCL2L1-      -----SRGG-----------------------------------------
A0A3P8U812_BCL2L1-      -----SRGG-----------------------------------------
E6ZFR0_BCL2L1-01        -----TSGQ----PG--TSSSS---------------------------G
G3P7B4_BCL2L1-01        -----QPGM----SS--PPPPP---------------------------S
A0A3Q3X5M5_BCL2L1-      -----SRGG--------LSPST---------------------------G
A0A2U9BIG9_BCL2L1-      -----NRCGQLGTDP--LPPDG---------------------------G
A0A3B3C5I4_BCL2L10      -------------------------------------------------Q
A0A3Q2Y539_MCL1-01      ------------------ELQTPPGQGVLDTETRRLIGRFL-RDFTGLST
H3AR18_MCL1-02          -----GDMAEFRKETLKLLRSYLCEVAGCESTETAFRFG---------LD
A0A3B1K5R1_MCL1-01      -----DCGEMAVGNCKQYETLDGDTREIISDFLRNFCGL---------SR
A0A3B4C6H5_MCL1-01      -----DCEELDSDQFKESETLDRDTSEIVIDFLQNFTGL---------SR
A0A3B4C6H5_MCL1-02      -----DCEELDSDQFKESETLDRDTSEIVIDFLQNFTGL---------SR
A0A3B4C6H5_MCL1-03      -----DCEELDSDQFKESETLDRDTSEIVIDFLQNFTGL---------SR
A0A3Q1IAB0_BCL2L10      -----CGLWKDTLALAEDYLSLCCTSP---------------------WP
Q5XGJ4_BCL2L2-01        ------------------------------------------------EP
A0A3P8WUE9_BCL2-01      -----ASTGPGNDGIPNLCKRP--------------------------PA
A0A3Q3G1D7_BCL2-01      -----ASSGPDRESIPHLCKRP--------------------------PQ
A0A3B4A3G8_BCL2-01      -----E----------RLCSAP--------------------------SD
D2ITA2_BCL2L1-02        ------------------------------------------------SP
A0A452FIG6_BCL2L1-      -----TGH----------------------------------------TE
A0A452FIG6_BCL2L1-      -----TGH----------------------------------------TE
Q8UWD6_MCL1-01          -----MDTREIIDTFLKIFTGL--------------------------PH
F8W4Q8_MCL1-01          -----MDTREIIDTFLKIFTGL--------------------------PH
Q568W5_MCL1-01          -----MDTREIIDTFLIIFTGL--------------------------PH
M3Y8D1_BCL2L10-01       ------------------------------------------------TR
H3ANS8_BCL2L1-01        -----LNGAVNGLPAGSSSRLEAQAVSG----------------------
F7G6M3_BCL2L2-01        ------------------------------------------------PG
G1TV33_BCL2L2-01        ------------------------------------------------PG
A0A2K5CWZ4_BCL2L2-      ------------------------------------------------PG
A0A2R8M4C0_BCL2L2-      ------------------------------------------------PG
G3TMU7_BCL2L2-01        ------------------------------------------------PG
A0A2K5CWZ4_BCL2L2-      ------------------------------------------------PG
A0A2K6TM77_BCL2L2-      ------------------------------------------------PG
A0A3P8W7K5_BCL2L10      --------------------------------------------------
A0A3B3ICL7_BCL2L1-      ------------------------------------------------CP
A0A452U2H8_BCL2A1-      -----RLIWPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYV-KHVLQIPQ
A0A452U2H8_BCL2A1-      -----RLIWPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYV-KHVLQIPQ
F7BXJ7_BCL2-01          -----AD---------SRGPPQSSLASAA-------ASS---------AA
A0A3B3TCS4_BCL2-01      -----AS------PVRSRTPRFDPHAR-----------------------
H0Z8G3_BCL2L1-01        -----VNGATVHQNSLEVHEIRRAAD------------------------
U3JSL7_BCL2L1-01        -----VNGASVHQSSLEVHEIRRAAD------------------------
Q4U2V6_BCL2L1-01        -----VNGATVHQSSLEVHEIRRAAD------------------------
A0A3P8YNB4_BCL2-01      -----VP------HISKWLSQPDPHA------------------------
A0A3P9AAB2_BCL2-01      -----DP------QFANRIPQPDPHAR-----------------------
A0A0U3DHY6_BCL2-01      -----DS------PFQNRSPQPDPHVR-----------------------
X4ZGI8_BCL2-01          ---------------SSDRRLQAPSAGGGNNSECLIANR---------VT
U3KEW4_BCL2-01          -----TSSDHTGPVSPHPEPPGSAAASPA-------PPA---------EG
Q00709_BCL2-01          -----ASSHH------RPEPPGSAAASEV-------PPA---------EG
K7F5Y4_BCL2-03          ---------------SSLSPPAAGSAAASNV-----PLG---------DG
G3WZW9_BCL2-01          -----QDLATSTTAAARNSPLPPPPAVAAATV----AAG---------PA
A0A452R145_BCL2-02      -----R----------RLPPPAAPAAAAA-------AAG---------PA
M3YYK3_BCL2-01          -----HR------RPQLTSPATALAAAA--------AAG---------PA
P10415_BCL2-04          -----RD------PVARTSPLQTPAAPGA-------AAG---------PA
A0A2K6R2I6_BCL2-02      -----RD------PVARTSPLPTPAAPAA-------AAG---------PA
J9NXG3_BCL2-01          -----XX------XXXXXXXXXX-------------XXX---------XX
A0A1D5QRF2_BCL2-01      -----RD------PVARTSPLPTPAAPAAAA-----AAG---------PA
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3ULB7_BCL2-01          ---------------TRTSPLQADP-----------AAQ---------PA
A9QXG9_BCL2-01          -----RD------PVARTSPLQTPAAPGA-------AAG---------PA
A0A2K5NZS5_BCL2-01      -----RD------PVARTSPLPTPAAPAA-------AAG---------PA
A0A0D9S017_BCL2-01      -----RD------PVARTSPLPTPAAPAA-------AAG---------PA
A0A2K6CIX3_BCL2-01      -----RD------PVARTSPLPTPAAPAA-------AAG---------PA
A0A2K5XRD4_BCL2-01      -----RD------PVARTSPLPTPAAPAA-------AAG---------PA
A0A2K6KHG1_BCL2-01      -----RD------PVARTSPLPTPAAPAA-------AAG---------PA
A0A2K6R2I6_BCL2-01      -----RD------PVARTSPLPTPAAPAA-------AAG---------PA
A0A2K5HK49_BCL2-01      -----RD------PVARTSPLPTPAAPAA-------AAG---------PA
G3QES9_BCL2-01          -----RD------RVARTSPLQTPAAPGA-------AAG---------PA
A0A2I3GZF9_BCL2-01      -----RD------PVARTSPLPTPAAPGA-------AAG---------PA
A0A2K6UEL3_BCL2-01      -----RD------PVARTXXXXXXXXXXX-------XXX---------XX
P10415_BCL2-01          -----RD------PVARTSPLQTPAAPGA-------AAG---------PA
P10415_BCL2-02          -----RD------PVARTSPLQTPAAPGA-------AAG---------PA
H2QEM8_BCL2-01          -----RD------PVARTSPLQTPAAPGA-------AAG---------PA
A0A2U4BHU7_BCL2-01      ---------------SRTSPPPPQTAPAAP------AGG---------PA
Q75SV7_BCL2-01          ---------------ARTSPPPPPAAPAAAAAAAADAAG---------PA
M3X1R9_BCL2-01          ---------------ARTSPPPPPVAPAAAAAAA--AAG---------PA
A0A076FU27_BCL2-01      ---------------SRTSPPPPPAA----------AAG---------PA
F6R2C4_BCL2-01          ---------------SRTSPPPPPAA----------AAG---------PA
O02718_BCL2-01          ---------------SRTSPPPPPAA----------AAG---------PA
A0A076FZV9_BCL2-01      ---------------SRTSPPPPPAA----------AAG---------PA
A0A452EV13_BCL2-01      ---------------SRTSPPPPPAA----------AAG---------PA
G1LID1_BCL2-01          -----RW------QVAP--PSAAAA-----------AAG---------PA
A0A452R145_BCL2-01      -----RR------LPPPAAPAAAAA-----------AAG---------PA
G3WZW9_BCL2-02          ------------------------------------AAG---------PA
G3ULB7_BCL2-02          ------------------------------------AAQ---------PA
A0A452T603_BCL2-01      --------------------------------------------------
G3PJT0_MCL1-01          ED---SED-----TDNDSLPCTPE--SDSETDVSDSPAGAA-ALESDTRQ
A0A3Q3VP02_MCL1-01      KDS--TDT-----DDDGSLPYTPDMSPDSELNVSGCLAGDE-LLEKDTRQ
A0A3B5K5B3_MCL1-01      EDS--QDT-----DHRSA-PCTPEMNSVNGLDVSGRPAEDEAALDNDTRQ
H2MLZ3_MCL1-01          -----HDV-----DDDGSLPNTPELECEASVS--GDNSGID-ALNEDTTE
H2MLZ3_MCL1-02          -----HDV-----DDDGSLPNTPELECEASVS--GDNSGID-ALNEDTTE
A0A3B3CEX1_MCL1-02      -----HD------DDGGSLPNTPELECDNSVL--VPND--P-PINQDTTE
A0A3B3CEX1_MCL1-01      -----HD------DDGGSLPNTPELECDNSVL--VPND--P-PINQDTTE
A0A3Q3B4V7_MCL1-01      -----ELG-----DDHGSLPSTPEVDGNPDVP---GGAEDE-VLENDTKH
A0A3Q3B4V7_MCL1-02      -----ELG-----DDHGSLPSTPEVDGNPDVP---GGAEDE-VLENDTKH
A0A3Q2EDX8_MCL1-01      DN---SAD------DGGSLPCTPEMPTDSHPATPGGHAGDE-ALDNDTKE
A0A3Q2T2A9_MCL1-02      EN---RDD--------GSLPSTPEMQADSEAAGCGSHAGQE-ALDSDTTE
A0A3Q2T2A9_MCL1-01      EN---RDD--------GSLPSTPEMQADSEAAGCGSHAGQE-ALDSDTTE
A0A3B5PQ55_MCL1-02      TS---SDD-----SDEGSLPCTPAQHPDSEKDATAVGASNQ-VLDNDTTE
A0A3B5PQ55_MCL1-01      TS---SDD-----SDEGSLPCTPAQHPDSEKDATAVGASNQ-VLDNDTTE
A0A3P9Q4R7_MCL1-02      ES---SDD-----SDEGSLPCTPAQQ-DGETDASAVRASNQ-VLDNDTTE
A0A3P9Q4R7_MCL1-01      ES---SDD-----SDEGSLPCTPAQQ-DGETDASAVRASNQ-VLDNDTTE
A0A087X830_MCL1-01      KS---SDD-----SDEGSLPCTPAQQ-DSETDASAVRASNQ-VLDNDTME
A0A3B3YCD0_MCL1-01      KS---SDD-----SDEGSLPCTPAQQ-DSETDASAVRASNQ-VLDNDTME
A0A3P8VKS9_MCL1-02      -----HCE-----VDEGSEPCTPEPHSEAELD--VSQAGDE-VLDTDTKE
A0A3P8VKS9_MCL1-01      -----HCE-----VDEGSEPCTPEPHSEAELD--VSQAGDE-VLDTDTKE
A0A3P8VKS9_MCL1-05      -----HCE-----VDEGSEPCTPEPHSEAELD--VSQAGDE-VLDTDTKE
A0A3P8VKS9_MCL1-04      -----HCE-----VDEGSEPCTPEPHSEAELD--VSQAGDE-VLDTDTKE
A0A3P8VKS9_MCL1-03      -----HCE-----VDEGSEPCTPEPHSEAELD--VSQAGDE-VLDTDTKE
I3JHR5_MCL1-01          -----RDR-----EEDGSLPSTPEYHLDGESD--------E-ELERETKL
A0A3Q4HLQ8_MCL1-01      -----RDR-----EEDGSLPSTPEFHSDSESD--------E-QLERETKL
A0A3P8NP63_MCL1-02      -----RDR-----EEDGSLPSTPEFHSDSESD--------E-QLERETKL
A0A3P8NP63_MCL1-03      -----RDR-----EEDGSLPSTPEFHSDSESD--------E-QLERETKL
A0A3Q2VNL8_MCL1-01      -----RDR-----EEDGSLPSTPEFHSDSESD--------E-QLERETKL
A0A3P8NP63_MCL1-01      -----RDR-----EEDGSLPSTPEFHSDSESD--------E-QLERETKL
A0A3P9BVM3_MCL1-01      -----RDR-----EEDGSLPSTPEFHSDSESD--------E-QLERETKL
A0A3B4G4Z6_MCL1-01      -----RDR-----EEDGSLPSTPEFHSDSESD--------E-QLERETKL
A0A2U9CJ81_MCL1-01      EDGGGGGD-----VGGGSLPSTPE--SDGEHDVSGCPAADE-ALDSFTRE
A0A3Q3IZW0_MCL1-01      VD---VSD-----IDNGSLPCSPVLQPDNEIEVSSSPAEYE-VLENDTRL
A0A3Q1GX28_MCL1-02      AN---SDD-----IEDGSLPCTPELMSDSEVDVSSCPAGDE-VLENDTRQ
A0A3Q1GX28_MCL1-01      AN---SDD-----IEDGSLPCTPELMSDSEVDVSSCPAGDE-VLENDTRQ
A0A3B4XKA5_MCL1-01      ED----SD-----VDDGSLPCTPEMQSDGETDVPSCPAG-E-VLESDTSQ
A0A3Q3GP42_MCL1-01      ------DD-----IEDGSLPCTPEPDSE--TEVSSCPTGGE-VLESDTRQ
A0A3Q3M6G2_MCL1-02      AD---TDD-----IEDGSLPCTPELQSD--SEAPSCPAGDE-VLENDTRQ
A0A3Q3M6G2_MCL1-01      AD---TDD-----IEDGSLPCTPELQSD--SEAPSCPAGDE-VLENDTRQ
W5MMB7_MCL1-01          -------------HADGSLPSTPDTPLDCGSVPEFLSEAHGQ-LNAETRE
A0A3B3R4U0_MCL1-01      DC---EHHLRASGNEDGSLPSTPGTPPDCGKMLTFPNRG----LSQETHE
A0A3B3SG34_MCL1-01      LP---GST-----NAVGSLPTSPDGDLPAYGPICGFSRSAVEMLDQETSE
Q4SW32_MCL1-01          ED-----------SEDGSLPCTPESHSGDVLDVSGRPAGDEAALDSDTRQ
D2ITA0_MCL1-03          DD---QEG-------NGSLPSTPELQSEVDTD---SQAGEEV-LDNDTKR
D2ITA0_MCL1-04          DD---QEG-------NGSLPSTPELQSEVDTD---SQAGEEV-LDNDTKR
Q0KFR9_MCL1-01          SD---RSN-----N-DDSLPCTPQMASECGPELSNCPSGDEV-LEHDTRQ
A0A3P8Y1W8_MCL1-01      SD---LAD-----DSDDSLPCTPLMVTECSAGLSHCPSGNEV-LDNDTRQ
A0A3P8Y1W8_MCL1-02      SD---LAD-----DSDDSLPCTPLMVTECSAGLSHCPSGNEV-LDNDTRQ
A0A3Q2XZL8_MCL1-01      NN---SDDDFDVESSDDSPPSTPDSQDSLVAD-----GRNDV-VDAETKG
A0A3B4AFB7_MCL1-02      EE---DYE-----NSEGSLPCTPEFHSDSEMELSSYSAEHEV-LESDTRQ
A0A3B3VM25_MCL1-01      ES---SD--------EGSLPCTPA-QQDSETVASAVRASNQV-LDNDTME
A0A3Q0RA11_MCL1-03      -----TDD-----VEDGSLPSTPEFHSDSES--------DEA-LERETKS
A0A3Q0RA11_MCL1-01      -----TDD-----VEDGSLPSTPEFHSDSES--------DEA-LERETKS
A0A3B4T8L9_MCL1-02      ED---SD------VDDGSLPCTPEIQSDGETDVPSCPAGDEV-LEDDTRQ
A0A3B4T8L9_MCL1-01      ED---SD------VDDGSLPCTPEIQSDGETDVPSCPAGDEV-LEDDTRQ
A0A3Q1EQB9_MCL1-02      QD---SDS-----MEDGSLPCTPELQSDSETDVSSCPTGDEL-LENDTRQ
A0A3B4ZKP6_MCL1-01      QV---SDS-----LEDSSLPCTPELQSDSETDVSSCPAGDEV-LENDTRQ
A0A3Q1BKL8_MCL1-02      QD---SDS-----MEEGSLPCTPELQSDSETDVSSCPAGDEL-LENDTRQ
A0A3Q1EQB9_MCL1-01      QD---SDS-----MEDGSLPCTPELQSDSETDVSSCPTGDEL-LENDTRQ
A0A3Q1BKL8_MCL1-01      QD---SDS-----MEEGSLPCTPELQSDSETDVSSCPAGDEL-LENDTRQ
A0A3P8RQX7_MCL1-02      QD---SDS-----MEEGSLPCTPELQSDSETDVSSCPAGDEL-LENDTRQ
A0A3P8RQX7_MCL1-01      QD---SDS-----MEEGSLPCTPELQSDSETDVSSCPAGDEL-LENDTRQ
U3JTB2_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
G1T1L8_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
E2RS00_BCL2A1-01        --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-02        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-02        --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
C7F841_BCL2A1-02        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
P70345_BCL2L2-03        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q0RA11_MCL1-02      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------KALKMMKRVVADVLEKHR---YAY
U3KKY6_MCL1-01          -----------------KKNK--------------------------KNL
G1MPY7_MCL1-01          -------------------------------------------------F
K7FPN7_MCL1-01          --------------------------------------------------
F6VJQ0_BCL2L10-01       -----------------PAPT-----PAAATLRLVSSELRQIYQ---DFF
A0A3Q1GS47_BCL2L1-      --------------------------AVKEALRDTANEFELRYA---RAF
A0A2K5DMS4_MCL1-01      -----------------AANS-----KALETLRGVGEGVPRNHE---MAL
A0A3P8V8T6_MCL1-01      --------------------------KALSTMKRVVKGILDKHR---HAF
B6V6J0_MCL1-01          -----------------VHH------KALETLLRVGGEIIEKHH---MAF
F7ETY1_MCL1-01          -----------------AHP------KALETLQRVGGDIIEKHH---MAF
A0A287APJ6_BCL2-01      -----------------FAIR-----GLAEALQMEVKPYNVYVT---VAY
H3AR18_MCL1-01          -----------------E--------KPLDTLRRVGDSIIDKHR---IAF
F7G4L5_BCL2L2-04        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6GWN0_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2R8M4C0_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K5CWZ4_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2I2YPX6_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6TM77_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
W5QDH5_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
D3Z5F7_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6MEE6_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6RW46_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A384DPS8_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K5MZX9_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K5HEK7_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K5V0Q3_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
F7G4L5_BCL2L2-05        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6EA73_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6AI30_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
G1RYB4_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2R9A7B2_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
H2Q805_BCL2L2-02        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2I3MUE4_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A287AW74_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A384DPS8_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
J7H260_MCL1-01          --------------------------KALPTMRRLGGDINEKHR---MAF
H0XHA5_MCL1-01          --------------------------------------------------
R4GAJ0_MCL1-01          -----------------SSPNEAEVARALETLRRVGESLREKHL---LAF
R4GAJ0_MCL1-02          -----------------SSPNEAEVARALETLRRVGESLREKHL---LAF
G1QAV8_MCL1-01          -----------------SQGP-----RVGGVQRRAAGCSGVRQE---TAF
A0A2K6F6N9_MCL1-01      ------------------------------------------------AF
M3XAP4_MCL1-03          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6GI15_MCL1-03      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
C8YZ26_MCL1-01          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5CFH3_MCL1-02      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
F7GTF7_MCL1-03          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6V5Y3_MCL1-03      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5LXU8_MCL1-03      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5I9Q7_MCL1-03      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2I2YQH7_MCL1-03      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
Q07820_MCL1-04          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5W0W9_MCL1-03      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
F7HUE9_MCL1-02          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6ECR0_MCL1-03      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5XSC7_MCL1-03      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2R9BYH6_MCL1-03      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
K7DE58_MCL1-03          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2I3M3D6_MCL1-03      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6KRW9_MCL1-03      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6PPL1_MCL1-03      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
K7DE58_MCL1-04          --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A1L1RNM6_MCL1-01      -----------------AVME-----KALETLRRVGDGVMQKHE---LAF
A0A1L1RNM6_MCL1-02      -----------------AVME-----KALETLRRVGDGVMQKHE---LAF
F6ZMX1_MCL1-01          -------------------SG-----KALETLRRVGDGVQRNHE---RAF
A0A286Y1M5_MCL1-01      -----------------PTSR-----KALETLRRVGDGVQRNHQ---TAF
P97287_MCL1-02          -----------------AAGR-----RALETLRRVGDGVQRNHE---TAF
P97287_MCL1-01          -----------------AAGR-----RALETLRRVGDGVQRNHE---TAF
G3T756_MCL1-01          -----------------AASR-----KALETLRRVADGVQRNHE---TAF
G1L3M8_MCL1-02          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2U3V2H3_MCL1-01      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
K9IWB2_MCL1-03          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
K9IWB2_MCL1-02          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
K9IWB2_MCL1-01          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
B4DU51_MCL1-01          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A287DCH9_MCL1-02      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A287DCH9_MCL1-01      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A452GAH0_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5I9Q7_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
G1PZ39_MCL1-01          -----------------ASSR-----KALETLRRVGDGVQRNHE---MAF
Q95KR3_MCL1-01          -----------------------------------------------SAF
A0A2K5EPY9_MCL1-02      ------------------------------------------------TC
A0A2K5EPY9_MCL1-01      ------------------------------------------------SS
J9PBC4_MCL1-01          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5C7L5_MCL1-01      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
Q9Z1P3_MCL1-01          -----------------AAGR-----RALETLRRVGDGVQRNHE---TAF
A5PJR2_MCL1-01          -----------------TTSR-----KALETLRRVGDGVQRNHE---TAF
A0A452GAH0_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
G1L3M8_MCL1-01          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
F7AVA6_MCL1-01          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
G1T2Q0_MCL1-02          -----------------SASR-----KALETLRRVGDGVQRNHE---TAF
G1T2Q0_MCL1-01          -----------------SASR-----KALETLRRVGDGVQRNHE---TAF
M3XAP4_MCL1-01          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
Q7YRZ9_MCL1-01          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
J9PBC4_MCL1-02          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
Q8HYS5_MCL1-01          -----------------AASR-----KALETLQRVGDGVQRNHE---TAF
M3XZZ5_MCL1-01          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A452RHX5_MCL1-01      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
H0XFB7_MCL1-01          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6GI15_MCL1-02      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
F7GTF7_MCL1-02          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5CFH3_MCL1-01      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6V5Y3_MCL1-01      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6KRW9_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6PPL1_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5XSC7_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A0D9RZP5_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5W0W9_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
I7G687_MCL1-01          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
F7HUE9_MCL1-01          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6ECR0_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2I3M3D6_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5LXU8_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2I3GB35_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
H2N5Y9_MCL1-01          -----------------ATCR-----KALETLRRVGDGVQRNHE---TAF
Q07820_MCL1-01          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2R9BYH6_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
K7DE58_MCL1-01          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2I2YQH7_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5I9Q7_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
M3XAP4_MCL1-02          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6GI15_MCL1-01      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
F7GTF7_MCL1-01          -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5CFH3_MCL1-03      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6V5Y3_MCL1-02      -----------------AASR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6KRW9_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6PPL1_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5LXU8_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5W0W9_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K6ECR0_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2I3M3D6_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2K5XSC7_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2I3GB35_MCL1-01      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
Q07820_MCL1-03          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2R9BYH6_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
K7DE58_MCL1-02          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
A0A2I2YQH7_MCL1-02      -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
G3WBC5_MCL1-01          ------------------RSG-----KALETLRRVGDGVQRNHE---TAF
W5QI41_MCL1-01          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
F1MQX4_MCL1-01          -----------------ATSR-----KALETLHRVGDGVQHNHE---TAF
B4DLY8_MCL1-01          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
B4DG83_MCL1-01          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
B4E3L8_MCL1-01          -----------------ATSR-----KALETLRRVGDGVQRNHE---TAF
F8W4Q8_MCL1-02          -----------------------------------------------WTL
G1QEX2_BCL2L10-01       -----------------QPST-----PEATVMRSLAAHSWLGTP---HSW
H3AAS7_BCL2L2-02        -----------------PPAN-----PLYRAMREAGDEFEARFH---RTF
H3AAS7_BCL2L2-01        -----------------PPAN-----PLYRAMREAGDEFEARFH---RTF
F6TEC3_BCL2L2-01        -----------------AASC-----SLHSAMRAAGDEFEERFR---QAF
G1Q051_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETHFR---CTF
G3WPT2_BCL2L2-01        -----------------PTNE-----PLHRAMRAAGDEFESRFR---RTF
P70345_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
O88996_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A3Q9B4M8_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
H0XR82_BCL2L2-01        -----------------PATD-----PLHQAMRAAGDEFETRFR---RTF
Q92843_BCL2L2-02        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
Q05KI8_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
Q1RMX3_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
Q45T69_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A452ECF0_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A286XQQ9_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K5MZX9_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A0D9RU30_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K5HEK7_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
F6PH48_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2I2UAE3_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2I2YPX6_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
I3ND50_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K5V0Q3_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
F7G4L5_BCL2L2-02        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
F7G4L5_BCL2L2-03        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6EA73_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6AI30_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
G1RYB4_BCL2L2-03        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2R9A7B2_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
H2Q805_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2I3MUE4_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6GWN0_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6MEE6_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6RW46_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6RW46_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6TM77_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A287AW74_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2U4CFE3_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A452SHI1_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A384DPS8_BCL2L2-      -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
F6U940_BCL2L2-01        -----------------PTTE-----PLHRAMRAAGDEFESRFR---RTF
G3WPT2_BCL2L2-02        -----------------PTNE-----PLHRAMRAAGDEFESRFR---RTF
W5QDH5_BCL2L2-02        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
Q7TS60_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
G1LMC3_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
M3Y5X5_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
G1P3J2_BCL2L2-01        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
I3ND50_BCL2L2-02        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
P70345_BCL2L2-04        -----------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
Q6GLI5_BCL2L1-01        -----------------IVGE-----EVLQALLDASEEFELRYQ---RAF
Q2TAP5_BCL2L1-01        -----------------IVEE-----EVLQALLEATEEFELRYQ---RAF
Q91828_BCL2L1-01        -----------------IVEE-----EVLQALLEATEEFELRYQ---RAF
I7GKS6_BCL2L1-01        ------------------------------MWKRTGLRPQKGLN---RRW
A0A2K5EBP4_BCL2L1-      ------------------------------MWKRTGLRPQKGLI---RRW
A0A2K6UWY8_BCL2L1-      ------------------------------MWKRTGLRPQKGLI---RRW
A0A3Q1LRT3_BCL2L1-      -----------------IPMT-----TVKQALREASNEFKLRYQ---QTF
A0A2K5M8B1_BCL2L1-      ------------------------------MWKRTGLRPQKGLN---RRW
A0A2K5H963_BCL2L1-      ------------------------------MWKRTGLRPQKGLN---RRW
G3RY91_BCL2L1-02        ------------------------------MWKRTGLRPQKGLN---RRW
A0A2K5VPG2_BCL2L1-      ------------------------------MWKRTGLRPQKGLN---RRW
F6UKR4_BCL2L1-02        ------------------------------MWKRTGLRPQKGLN---RRW
A0A2K5YR37_BCL2L1-      ------------------------------MWKRTGLRPQKGLN---RRW
A0A2K6LPM4_BCL2L1-      ------------------------------MWKRTGLRPQKGLN---RRW
A0A2K6QFA2_BCL2L1-      ------------------------------MWKRTGLRPQKGLN---RRW
A0A2K6G3C5_BCL2L1-      ------------------------------MQKRTGLRPQKRLN---RRW
H9GHK7_BCL2L1-01        -----------------NPRV-----DVSQTLREAGDEFELRYR---RAF
Q07816_BCL2L1-04        -----------------VRAS-----DVRQALRDAGDEFELR-----GFV
Q07817_BCL2L1-02        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2K5YR37_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A452E1B1_BCL2L1-      -----------------IPTA-----VVKQALREASNECELRYQ---QTF
W5PSA5_BCL2L1-01        -----------------IPMA-----VVKQALREASNECELRYQ---QTF
Q07816_BCL2L1-01        -----------------VRAS-----DVRQALRDAGDEFELRYR---RAF
Q07816_BCL2L1-03        -----------------VRAS-----DVRQALRDAGDEFELRYR---RAF
Q07816_BCL2L1-02        -----------------VRAS-----DVRQALRDAGDEFELRYR---RAF
G1N5N5_BCL2L1-01        -----------------VRAS-----DVRQTLRDAGDEFELRYR---RAF
A0A452ILL8_BCL2L1-      -----------------VPAT-----GVRQALREAGDEFELRYR---RAF
A0A452ILL8_BCL2L1-      -----------------VPAT-----GVRQALREAGDEFELRYR---RAF
K7F655_BCL2L1-01        -----------------VPAA-----EVRQALREAGDEFELRYR---RAF
A0A287CZ07_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELWYW---RAF
F6WA14_BCL2L1-01        -----------------IPVA-----AVKQALREAGDEFELRYR---RAF
G3WKX6_BCL2L1-01        -----------------IPVA-----AVKQALREAGDEFELRYR---RAF
F6WQI0_BCL2L1-02        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
G3SPN0_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
H0X6V2_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q2PFS6_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
P53563_BCL2L1-02        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
P53563_BCL2L1-03        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
O35843_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
G1RER8_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q64373_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q64373_BCL2L1-09        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
P53563_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2U3V0P1_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
O77737_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q9MYW4_BCL2L1-01        -----------------IPMT-----AVKQALREAGDEFELRYR---RAF
F6WQI0_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
B2Z3Z4_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q05KJ0_BCL2L1-02        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q05KJ0_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
E2IV76_BCL2L1-01        -----------------IPMA-----AVKQALKEAGDEFELRYR---RAF
A0A2K6G3C5_BCL2L1-      -----------------IPMA-----AVKQALKEAGDEFELRYR---RAF
M3Z2H9_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A0D9RJZ8_BCL2L1-      -----------------IPMA-----AVKQTLREAGDEFELRYR---RAF
A0A286Y5D6_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A1L5BWY3_BCL2L1-      -----------------IPMT-----AVKQALREAGDEFELRYR---RAF
I3MUP5_BCL2L1-03        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
I3MUP5_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
I3MUP5_BCL2L1-02        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
G1P9D2_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2K5EBP4_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
E2IV75_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
F7IT34_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
F7IT34_BCL2L1-02        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q76LT7_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2K5M8B1_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2K5H963_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
M3XA94_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q8SQ42_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
G3RY91_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q07817_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q07817_BCL2L1-03        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2K5VPG2_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
F6UKR4_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2K5YR37_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2J8VIH3_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2K6LPM4_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2K6QFA2_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2K6QFA2_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A2K6UWY8_BCL2L1-      -----------------IPMA-----AIKQALREAGDEFELRYR---RAF
E2IV77_BCL2L1-01        -----------------IPMA-----AIKQALREAGDEFELRYR---RAF
A0A452SDS4_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A384D3U1_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A452FWV3_BCL2L1-      -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q9MZS7_BCL2L1-01        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q64373_BCL2L1-03        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
Q64373_BCL2L1-04        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
P53563_BCL2L1-04        -----------------IPMA-----AVKQALREAGDEFELRYR---RAF
A0A3B1IEV7_MCL1-01      -----------------REQS-----PALRTMSRVVAGVVLKHG---IAY
A0A3B4E3I4_MCL1-03      -----------------RDQH-----PAHGTMSRVVEGVILKHS---IAY
A0A3B4E3I4_MCL1-02      -----------------RNQH-----PASDTLSRVVEGMLHKHS---VAY
A0A3B4E3I4_MCL1-01      -----------------RNQH-----PASDTLSRVVEGMLHKHS---VAY
A0A3Q3B0R2_BCL2-01      -----------------EPLA-----HIHRVLREAGDELERLYQ---PDF
A0A3Q2PN77_BCL2-01      -----------------DPHA-----DIHRVLREAGDELERLYQ---LDF
A0A1X9JZA1_BCL2-01      -----------------DPHA-----AIHRVLREAGDELERLYQ---PDF
A0A3Q0S5Z7_BCL2-01      -----------------DPHA-----DIHRVLREAGDELERLYQ---PDF
A0A3P8QVM8_BCL2-01      -----------------DPHA-----GIHRVLREAGDELERLYQ---PDF
A0A3P9DIG5_BCL2-01      -----------------DPHA-----GIHRVLREAGDELERLYQ---PDF
A0A3Q2UYW8_BCL2-01      -----------------DPHA-----GIHRVLREAGDELERLYQ---PDF
A0A3B4G3K4_BCL2-01      -----------------DPHA-----GIHRVLREAGDELERLYQ---PDF
A0A3Q1I5N1_BCL2-01      -----------------DPHA-----ALHRVLREAGDELERLYQ---PDF
A0A3Q3K1K1_BCL2-01      -----------------DMHA-----AIHRVLREAGDELERLYQ---PDF
A0A3Q3MEY1_BCL2-01      -----------------DPQA-----AIHRVLREAGDELERLYQ---PDF
A0A3Q1FLK7_BCL2-01      -----------------DPHA-----AIHRVLREAGDELERLYQ---PDF
A0A3Q1B8C3_BCL2-01      -----------------DPHA-----AIHRVLREAGDELERLYQ---PDF
A0A3P8S9L3_BCL2-01      -----------------DPHA-----AIHRVLREAGDELERLYQ---PDF
A0A3B5BBQ0_BCL2-01      -----------------DPHA-----AIHRVLREAGDELERLYQ---PDF
A0A3B4TX71_BCL2-01      -----------------DPHA-----EIHRVLREAGDELERLYQ---PDF
A0A3B4YAG2_BCL2-01      -----------------DPHA-----EIHRVLREAGDELERLYQ---PDF
A0A286XUI2_BCL2A1-      -------------------PS-----KASKVLQDMALSVQEEVE---RRL
Q564A4_BCL2-01          -----------------DPHL-----RLYRVLRDAGDEIERIYQ---REF
W5N4F7_BCL2-01          -----------------DPHA-----ALHKVLREAGDEIERMYH---RDF
A0A3Q4MN81_BCL2L10      -----------------PPPS-----ESAAAMRRLGWDIERQHQ---ARF
A0A3B4ETX9_BCL2L10      -----------------PPPS-----ESAAAMRRLGWDIERQHQ---ARF
D2IT42_BCL2L10-02       -----------------PPPS-----ESAAAMRGLAQDMERQHY---ARF
A0A3Q0S9R1_BCL2L10      -----------------PPPS-----ESAAAMRRLGQDIERQHQ---ARF
I3J363_BCL2L10-01       -----------------PPPS-----ESAAAMRRLGWDIERQHQ---ARF
A0A3Q2UUP0_BCL2L10      -----------------PPPS-----ESAAAMRRLGWDIERQHQ---ARF
A0A3P8PVZ8_BCL2L10      -----------------PPPS-----ESAAAMRRLGWDIERQHQ---ARF
A0A3Q2UUP0_BCL2L10      -----------------PPPS-----ESAAAMRRLGWDIERQHQ---ARF
A0A3P9BLI0_BCL2L10      -----------------PPPS-----ESAAAMRRLGWDIERQHQ---ARF
A0A3Q2PJS5_BCL2L10      -----------------PPPS-----EPAAAMRRLAQDVESQHQ---ARF
A0A3Q2GL87_BCL2L10      -----------------PPPS-----EPAAAMRRLAQDMETQHQ---ARF
A0A3B5MJ12_BCL2L10      -----------------PPPS-----EPAAAMRRLAQDVEAKHQ---ARF
M4AUW7_BCL2L10-01       -----------------PPPS-----EPAAAMRRLAQDVEAKHQ---ARF
A0A096ME02_BCL2L10      -----------------PPPS-----EPAAAMRRLAQDVEAQHQ---ARF
A0A3B3TYN4_BCL2L10      -----------------PPPS-----EPAAAMRRLAQDVEAQHQ---ARF
A0A3B3YT99_BCL2L10      -----------------PPPS-----EPAAAMRRLAQDVEAQHQ---ARF
A0A3P9NE65_BCL2L10      -----------------PPPS-----EPAAAMRRLAQDVEAQHQ---ARF
A0A3P9LM07_BCL2L10      -----------------PPPS-----ESAAAMRRLAQDMEAQYQ---PRF
H2MBQ3_BCL2L10-01       -----------------PPPS-----ESAAAMRRLAQDMEAQYQ---PRF
A0A3B4AAV4_BCL2L10      -----------------PPPS-----GSASAMRRLGQDMEAQHK---ARF
A0A3Q3EZU5_BCL2L10      -----------------PPPS-----MSAAAIRRLAQDMEKQHQ---ARF
A0A3Q3EZU5_BCL2L10      -----------------PPPS-----MSAAAIRRLAQDMEKQHQ---ARF
A0A3Q3JQ78_BCL2L10      -----------------PPPS-----ESAAAMRCLAQDMETQHQ---ARF
A0A3B4TIY6_BCL2L10      -----------------PPPS-----ESAAAMRSMAQDMETQHQ---ARF
A0A3B4WGF4_BCL2L10      -----------------PPPS-----ESAAAMRGMAQDMETQHQ---ARF
A0A3Q3KZW1_BCL2L10      -----------------PPPS-----ESAAAMRCLAQKMERQHQ---ARF
A0A3B5KD08_BCL2L10      -----------------PPPS-----ESATAMRHLGQDMEKQHQ---ARF
A0A3Q3VI28_BCL2L10      -----------------PPPS-----ESAAAMRDLAQDMEKQHQ---ARF
A0A3Q1GM98_BCL2L10      -----------------PPPS-----ESAAAMRRLAQDMEKQHQ---ARF
A0A3Q1D2L0_BCL2L10      -----------------PPPS-----ESAAAMRRLAQDMEKQHQ---ARF
A0A3P8RL82_BCL2L10      -----------------PPPS-----ESAAAMRRLAQDMEKQHQ---ARF
A0A3B4ZFS0_BCL2L10      -----------------PPPS-----ESAAAMRCLAQDMEKQHQ---ARF
A0A3B4AFB7_MCL1-01      -----------------WKQR-----PALSTMKGVVDKLLEKHR---YAY
B9ZYL7_BCL2-01          ADGDNNDADGGDEAVMQPVPS-----AVLQTLSRAGDEFSRLYQ---QDF
A0A452I9V7_BCL2-01      LR---------------PAPQ-----AVLLALCQAGDEFSRRYH---RDF
H9GPE7_BCL2-01          -----------------PVPQ-----VVHTTLRQAGDEFSRRYR---RDF
A0A3Q2HRY3_BCL2-02      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
K7F5Y4_BCL2-02          LR---------------SAPQ-----AVHLTLCQAGDEFSRRYH---RDF
K7F5Y4_BCL2-01          LR---------------SAPQ-----AVHLTLCQAGDEFSRRYH---RDF
F6YNL8_BCL2-01          VS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
H0YUX3_BCL2-01          LR---------------PAPQ-----AVHLVLRQAGDEFSRRYQ---RDF
H0W1T3_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---QDF
J9NXG3_BCL2-02          XS---------------PVPP-----VVHLTLRQAGDDFSRRYR---R-F
G1LID1_BCL2-02          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
I3MVK9_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
G1TW27_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
P10417_BCL2-02          LS---------------PVPP-----VVHLTLRRAGDDFSRRYR---RDF
A0A096MPU7_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
P10417_BCL2-01          LS---------------PVPP-----VVHLTLRRAGDDFSRRYR---RDF
Q7TSN8_BCL2-01          LS---------------PVPP-----VVHLTLRRAGDDFSRRYR---RDF
Q6R755_BCL2-01          LS---------------PVPP-----VVHLTLRRAGDDFSRRYR---RDF
Q9JJV8_BCL2-01          LS---------------PVPP-----VVHLTLRRAGDDFSRRYR---RDF
Q923R6_BCL2-01          LS---------------PVPP-----VVHLTLRRAGDDFSRRYR---RDF
F1LNV0_BCL2-01          LS---------------PVPP-----VVHLTLRRAGDDFSRRYR---RDF
P49950_BCL2-01          LS---------------PVPP-----VVHLTLRRAGDDFSRRYR---RDF
H2NWH5_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A3Q2HRY3_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K6G3I7_BCL2-01      PS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A287APJ6_BCL2-03      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
H0WKI0_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K5UDI5_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K5EB04_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2R8MY14_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
Q568V1_MCL1-01          VD---------------RKLH-----HAIPTMKRVVDNILVKHQ---IAY
Q1L8X3_MCL1-01          VD---------------RKLH-----HAIPTMKRVVDNILVKHQ---IAY
Q9I9N3_MCL1-01          VD---------------RKLH-----HAIPTMKRVVDNILVKHQ---IAY
A0A3B3ICL7_BCL2L1-      -----------------S-MD-----AIKSTLKDSADEFERRFH---QGF
A0A3B3E2W4_BCL2L1-      -----------------S-MD-----AIKSTLKDSANEFERRFS---QGF
A0A3B5B4X7_BCL2L1-      -----------------G-IE-----AVKAALKDSADEFELLFT---QAF
A0A3B4BFZ8_BCL2L1-      -----------------H-LD-----AIKTALTDSADEFEELFT---QAF
A0A3Q3FUB6_BCL2L1-      -----------------D-IE-----AVKAALLDSADEFELLFT---QAF
A0A3B5MGS2_BCL2L1-      -----------------G-VE-----VVKSVLKDAAEEFERLYT---QSF
M4A558_BCL2L1-01        -----------------G-VE-----VVKSVLKDAAEEFERLYT---QSF
A0A3P9QFB3_BCL2L1-      -------------------VE-----VVKSVLKDAAEEFERLYT---QSF
A0A087YBW4_BCL2L1-      -----------------G-VK-----VVKLVLKDAAEEFERLYT---QSF
A0A3B3VWI7_BCL2L1-      -----------------G-VK-----VVKLVLKDAAEEFERLYT---QSF
A0A3B3XN57_BCL2L1-      -----------------G-VE-----VVKSVLKDAAEEFERLYT---QSF
A0A3Q2C6K4_BCL2L1-      -----------------S-IE-----AVKSALKDSANEFELLFS---QSF
A0A3Q2NRP4_BCL2L1-      -----------------R-AE-----AVKSALRDSADEFEHLFT---QSF
A0A0B4KJI5_BCL2L1-      -------------------IE-----AVKAALRDSSEEFELLFT---QAF
A0A3Q1JZ46_BCL2L1-      -----------------S-ME-----AVKTALRDSADEFELLFT---QAF
A0A3Q1JZ46_BCL2L1-      -----------------S-ME-----AVKTALRDSADEFELLFT---QAF
A0A3Q3NFM4_BCL2L1-      -----------------G-VE-----AVKAALRDSAEEFELLFT---QAF
A0A3Q3NFM4_BCL2L1-      -----------------G-VE-----AVKAALRDSAEEFELLFT---QAF
A0A3B4V9K8_BCL2L1-      -----------------G-IE-----AVKSALKDSADEFELLFN---QAF
A0A3B4XS24_BCL2L1-      -----------------G-IE-----AVKSALKDSADEFELLFN---QAF
C1BLI0_BCL2L1-01        -----------------G-IE-----AVKAALRDSADEFELRYT---RAF
C0HAD8_BCL2L1-01        -----------------G-ME-----PVKAALRDSVDEFELRYT---RAF
A0A3B3ZN55_BCL2L1-      LD---------------S-AS-----DSAPALRDSANEFELRFS---RAF
A0A3B5K6B9_BCL2L1-      -T---------------S-LD-----TVKEALRDTGNEFELRYT---CAF
A0A3B5K6B9_BCL2L1-      -T---------------S-LD-----TVKEALRDTGNEFELRYT---CAF
H3CH49_BCL2L1-01        LT---------------S-LD-----AVKEALRDTGNEFELRYT---CAF
A0A3B3TFR4_BCL2L1-      -Q---------------G-LE-----AVKEALRLSANEFEFRYQ---RAF
A0A3Q2FR43_BCL2L1-      TA---------------A-ME-----AVKAALRDTACEFELRYA---RAF
A0A3P8XYL5_BCL2L1-      -----------------G-LD-----AVKEALRDSANEFELRYA---LAF
Q90Z98_BCL2L1-02        SG---------------G-LD-----AVKEALRDSANEFELRYS---RAF
Q90Z98_BCL2L1-01        SG---------------G-LD-----AVKEALRDSANEFELRYS---RAF
A0A059PJI5_BCL2L1-      SA---------------S-LE-----AVKEALRDSGNEFELRYS---RAF
A0A3B4DTL9_BCL2L1-      AG---------------G-LD-----AVKEALRDSANEFELRYS---RAF
B5XAY3_BCL2L1-01        TA---------------G-LD-----AVKEALRDSANEFELRYA---RAF
W5MG74_BCL2L1-01        -------------------IE-----AVQGALRDSANEFELRYG---RAF
A0A3Q3B3X5_BCL2L1-      TA---------------N-MD-----KVKEALRDTANEFELRYA---RAF
A0A3B3IB64_BCL2L1-      TT---------------N-MD-----AVKEALRDTANEFELRYA---LAF
A0A3P9JYH1_BCL2L1-      TT---------------N-MD-----AVKEALRDTANEFELRYA---LAF
A0A3B3DHA1_BCL2L1-      TT---------------N-MD-----AVKEALRDTANEFELRYA---LAF
A0A3Q0RTF8_BCL2L1-      TT---------------N-LD-----AVKEALRDTANEFELRYA---RAF
I3IZK7_BCL2L1-01        TT---------------D-LD-----AVKEALRDTANEFELRYA---RAF
A0A2U9BY16_BCL2L1-      SP---------------S-LD-----AVKEALRDSANEFELRYA---RAF
A0A0D6DR75_BCL2L1-      PT---------------S-LD-----AVKEALRDSANEFELRYA---RAF
A0A3Q3WIW8_BCL2L1-      TT---------------S-LD-----AVKDALRDSANEFELRYA---RAF
A0A219P0Y3_BCL2L1-      TT---------------S-LD-----AVKEALRDSANEFELRYA---RAF
A0A3Q3MX20_BCL2L1-      TA---------------S-LD-----AVKEALRDSANEFELRYA---RAF
A0A3Q3G2E1_BCL2L1-      TT---------------N-LD-----AVKEALRDSANEFELRYA---SAF
A0A3Q3G2E1_BCL2L1-      TT---------------N-LD-----AVKEALRDSANEFELRYA---SAF
A0A3Q3G2E1_BCL2L1-      TT---------------N-LD-----AVKEALRDSANEFELRYA---SAF
A0A3Q1GZ93_BCL2L1-      TT---------------S-LD-----AVKEALRDSANEFELRYA---RAF
A0A3Q1GZ93_BCL2L1-      TT---------------S-LD-----AVKEALRDSANEFELRYA---RAF
A0A3Q1GZ93_BCL2L1-      TT---------------S-LD-----AVKEALRDSANEFELRYA---RAF
A0A3B4V3T1_BCL2L1-      TT---------------S-LD-----AVKEALRDSANEFELRYS---RAF
A0A3B4XU17_BCL2L1-      TT---------------S-LD-----AVKEALRDSANEFELRYS---RAF
A0A3B3QRZ2_BCL2L1-      G------------------LE-----AVKEALRDSANEFELRYS---RAF
A0A3B3ZN55_BCL2L1-      -------------------LD-----AVKEALRDSANEFELRFS---RAF
G3NJY1_BCL2L1-01        S------------------LD-----AVKEALRDSANEFELRYA---RAF
A0A3Q3DUT7_BCL2L1-      -------------------LD-----AVKEALRDSANEFELRYS---HAF
A0A3Q3DUT7_BCL2L1-      -------------------LD-----AVKEALRDSANEFELRYS---HAF
A0A3Q3DUT7_BCL2L1-      -------------------LD-----AVKEALRDSANEFELRYS---HAF
A0A3B1JJ42_BCL2L1-      -------------------LD-----AVKEALRDSANEFELRYS---RAF
A0A3P8UWG7_BCL2L1-      S------------------LD-----SIKEALRDSANEFELRYA---RAF
A0A3Q3IVF5_BCL2L1-      N------------------LD-----AVKEALRDSANEFELRYA---RAF
A0A3Q1DHJ3_BCL2L1-      -------------------MD-----AVKEALRDTANEFELRYA---RAF
A0A3Q1DHJ3_BCL2L1-      -------------------MD-----AVKEALRDTANEFELRYA---RAF
A0A3Q1DHJ3_BCL2L1-      -------------------MD-----AVKEALRDTANEFELRYA---RAF
A0A3P8TL99_BCL2L1-      -------------------MD-----AVKEALRDTANEFELRYA---RAF
A0A3P8TL99_BCL2L1-      -------------------MD-----AVKEALRDTANEFELRYA---RAF
A0A3Q1GS47_BCL2L1-      -------------------MD-----AVKEALRDTANEFELRYA---RAF
A0A3B4Z3X2_BCL2L1-      -------------------MD-----AVKEALRDTANEFELRYA---RAF
A0A3B4Z3X2_BCL2L1-      -------------------MD-----AVKEALRDTANEFELRYA---RAF
C3VIT1_BCL2L1-01        TT---------------TRLD-----AVKEALRDTANEFELRYA---RAF
A0A3P8P0F1_BCL2L1-      TD-----------------LD-----AVKEALRDTANEFELRYA---RAF
A0A3Q2X557_BCL2L1-      TD-----------------LD-----AVKEALRDTANEFELRYA---RAF
A0A3P9D632_BCL2L1-      TD-----------------LD-----AVKEALRDTANEFELRYA---RAF
A0A3P9D632_BCL2L1-      TD-----------------LD-----AVKEALRDTANEFELRYA---RAF
A0A3Q4N4B5_BCL2L1-      TD-----------------LD-----AVKEALRDTANEFELRYA---RAF
A0A3B4FNX1_BCL2L1-      TD-----------------LD-----AVKEALRDTANEFELRYA---RAF
A0A3Q2QPL9_BCL2L1-      -------------------ME-----AVKVALRETACEFELRYA---RAF
A0A3B5PQJ0_BCL2L1-      -------------------MD-----AVKVALRDTAREFELRYS---RAF
A0A087X9B7_BCL2L1-      -------------------MD-----AVKVTLRDTAREFELRYS---RAF
A0A3B3TUS7_BCL2L1-      -------------------MD-----AVKVTLRDTAREFELRYS---RAF
A0A3B3WI27_BCL2L1-      -------------------MD-----AVKVTLRDTAREFELRYS---RAF
A0A3P9N9Y4_BCL2L1-      -------------------MD-----AVKVTLRDTAREFELRYS---RAF
A0A3Q3BEB7_BCL2L1-      SD-----------------IE-----AVKSALKDSADEFERLYT---QSF
A0A3P8VMA1_BCL2L1-      SG-----------------AE-----AVKAALKDSADEFELRFT---QAF
A0A345BSW9_BCL2L1-      GG-----------------LD-----AVKEALRDSANEFELRYS---RAF
A0A286MU87_BCL2L1-      GG-----------------ME-----PVKAALRDSVDEFELRYT---RAF
A0A3P8XFS0_BCL2L1-      GC-----------------ME-----AVKAALRDSADEFELRYT---RAF
A0A3P8XFS0_BCL2L1-      GC-----------------ME-----AVKAALRDSADEFELRYT---RAF
A0A0F7L1T6_BCL2L1-      AG-----------------IE-----AVNAALRDSAEEFEKLFA---QAF
H2U5I3_BCL2L1-01        AG-----------------IE-----AVNAALRDSAEEFEKLFA---QAF
H2U5I3_BCL2L1-02        AG-----------------IE-----AVNAALRDSAEEFEKLFA---QAF
A0A3Q3J5K3_BCL2L1-      -------------------IE-----AVKAALRDSADEFELRFT---QAF
A0A3Q1EVP6_BCL2L1-      -------------------IE-----AVKSTLKDAADEFELLFT---QTF
A0A3Q1BQA0_BCL2L1-      -------------------IE-----AVKSALKDAADEFELLFT---QAF
A0A3P8U812_BCL2L1-      -------------------IE-----AVKSALKDAADEFELLFT---QAF
E6ZFR0_BCL2L1-01        AD-----------------IE-----AVKAALRDSADEFELLFT---QAF
G3P7B4_BCL2L1-01        GD-----------------TE-----AVKAALQDSANEFELLFT---QAF
A0A3Q3X5M5_BCL2L1-      AD-----------------ME-----AVKSALRDSANEFEQLFT---QAF
A0A2U9BIG9_BCL2L1-      -------------------VG-----AVKEALRDSAHEFEQLFN---QAF
A0A3B3C5I4_BCL2L10      AP---------------PPPS-----ESASAMRRLAQDMETQYQ---PRF
A0A3Q2Y539_MCL1-01      AA---------------WIQS-----KAQSTMKRVVTRLVDKHR---ILF
H3AR18_MCL1-02          QW---------------SGGE-----KPLDTLRRVGDSIIDKHR---IAF
A0A3B1K5R1_MCL1-01      SC---------------GGHG-----AVVQTMKRVVDDLVVKHG---IAY
A0A3B4C6H5_MCL1-01      SC---------------GRHR-----GVVQTIRRVVDGLVVKHE---LVY
A0A3B4C6H5_MCL1-02      SC---------------GRHR-----GVVQTIRRVVDGLVVKHE---LVY
A0A3B4C6H5_MCL1-03      SC---------------GRHR-----GVVQTIRRVVDGLVVKHE---LVY
A0A3Q1IAB0_BCL2L10      AP---------------PPPS-----ESAAAMRRLAQDMEKQHQ---VRF
Q5XGJ4_BCL2L2-01        AG---------------AASC-----SLHSAMRAAGDEFEERFR---QAF
A0A3P8WUE9_BCL2-01      PE---------------A-HA-----AIHRVLREAGDELERLYQ---PDF
A0A3Q3G1D7_BCL2-01      SD---------------PAYA-----DIHRVLREAGDELERLYQ---PDF
A0A3B4A3G8_BCL2-01      P------------------HA-----AIHRVLREAGDELERLYQ---PDF
D2ITA2_BCL2L1-02        TP---------------QGTE-----AVRAALLESVEEFELRYT---LAF
A0A452FIG6_BCL2L1-      ES---------------GPVA-----TAQQAPREAGSEFELRHQ---QTV
A0A452FIG6_BCL2L1-      ES---------------GPVA-----TAQQAPREAGSEFELRHQ---QTV
Q8UWD6_MCL1-01          SK---------------SGRK-----QVLSTMRRVVDNLAVKHE---LAY
F8W4Q8_MCL1-01          SK---------------SGRK-----QVLSTMRRVVDNLAVKHE---LAY
Q568W5_MCL1-01          SK---------------SGRK-----QVLSTMRRVVDNLAVKHE---LAY
M3Y8D1_BCL2L10-01       EA---------------AVLR-----SVAAVVRQRHERFLSDYRGYGGNR
H3ANS8_BCL2L1-01        -------------------PE-----AVKRTLREAGEEFELRYS---RAF
F7G6M3_BCL2L2-01        EG---------------PPAQ-----PLHRAMRAAGDEFESRFR---RAF
G1TV33_BCL2L2-01        EG---------------PAAN-----PLHQAMRAAGDEFETRFR---QNF
A0A2K5CWZ4_BCL2L2-      EG---------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2R8M4C0_BCL2L2-      EG---------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
G3TMU7_BCL2L2-01        EG---------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K5CWZ4_BCL2L2-      EG---------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A2K6TM77_BCL2L2-      EG---------------PAAD-----PLHQAMRAAGDEFETRFR---RTF
A0A3P8W7K5_BCL2L10      -----------------PPPS-----ESAAAMRHLAQDMEKQHQ---ARF
A0A3B3ICL7_BCL2L1-      CC---------------ASMD-----AIKSTLKDSADEFERRFH---QGF
A0A452U2H8_BCL2A1-      PG---------------SAPS-----RASQVLRDVASSVQGEVE---KNL
A0A452U2H8_BCL2A1-      PG---------------SAPS-----RASQVLRDVASSVQGEVE---KNL
F7BXJ7_BCL2-01          MQ---------------PVPP-----AVLQTLSRAGDEFSRLYQ---QDF
A0A3B3TCS4_BCL2-01      ---------------------------LHRVLREAGDEIERMFQ---RDF
H0Z8G3_BCL2L1-01        ---------------------------VRQALREAGDEFELRYR---RAF
U3JSL7_BCL2L1-01        ---------------------------VRQALREAGDEFELRYR---RAF
Q4U2V6_BCL2L1-01        ---------------------------VRQALREAGDEFELRYR---RAF
A0A3P8YNB4_BCL2-01      --------------------------AIHRVLREAGDELERLYQ---PDF
A0A3P9AAB2_BCL2-01      ---------------------------LHRVLRDAGNEIERMYQ---RDF
A0A0U3DHY6_BCL2-01      ---------------------------LHRVLREAGDEIERMYL---RDF
X4ZGI8_BCL2-01          RS---------------DPYS-----RIYRSLREAGDQIERMYQ---REF
U3KEW4_BCL2-01          LR---------------PAPQ-----VVHLVLRQAGDEFSRRYQ---RDF
Q00709_BCL2-01          LR---------------PAPP-----GVHLALRQAGDEFSRRYQ---RDF
K7F5Y4_BCL2-03          LR---------------SAPQ-----AVHLTLCQAGDEFSRRYH---RDF
G3WZW9_BCL2-01          VS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A452R145_BCL2-02      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
M3YYK3_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
P10415_BCL2-04          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K6R2I6_BCL2-02      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
J9NXG3_BCL2-01          XS---------------PVPP-----VVHLTLRQAGDDFSRRYR---R-F
A0A1D5QRF2_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2R9APW6_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
G3ULB7_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A9QXG9_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K5NZS5_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A0D9S017_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K6CIX3_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K5XRD4_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K6KHG1_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K6R2I6_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K5HK49_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
G3QES9_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2I3GZF9_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2K6UEL3_BCL2-01      XS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
P10415_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
P10415_BCL2-02          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
H2QEM8_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A2U4BHU7_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
Q75SV7_BCL2-01          PS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
M3X1R9_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A076FU27_BCL2-01      PS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
F6R2C4_BCL2-01          PS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
O02718_BCL2-01          PS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A076FZV9_BCL2-01      PS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A452EV13_BCL2-01      PS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
G1LID1_BCL2-01          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A452R145_BCL2-01      LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
G3WZW9_BCL2-02          VS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
G3ULB7_BCL2-02          LS---------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
A0A452T603_BCL2-01      -----------------PVPP-----VVHLTLRQAGDDFSRRYR---RDF
G3PJT0_MCL1-01          LLGRFLREFTGLSKTQWNPSR-----ELT-TMKRVVGDVLEKHR---YVF
A0A3Q3VP02_MCL1-01      LISRVLMELSGHGRARWTESR-----TLS-TMKRVVAELLEKHR---YVY
A0A3B5K5B3_MCL1-01      LLSCFMADFCGIGSHQWRESG-----ALS-TMKRVVANLMEKHR---YVY
H2MLZ3_MCL1-01          FLTNFFRNFVGISQYRHRDNK-----YMS-TAKRVVNDVLEKHK---ITY
H2MLZ3_MCL1-02          FLTNFFRNFVGISQYRHRDNK-----YMS-TAKRVVNDVLEKHK---ITY
A0A3B3CEX1_MCL1-02      FLTNFFRNYVGLSQSRHRESK-----YIS-TAKRVVNDMMDKHR---FAF
A0A3B3CEX1_MCL1-01      FLTNFFRNYVGLSQSRHRESK-----YIS-TAKRVVNDMMDKHR---FAF
A0A3Q3B4V7_MCL1-01      LISRFLQEFTGLSKRQWSESK-----ELS-TMNRVVEDLLTKHR---FAY
A0A3Q3B4V7_MCL1-02      LISRFLQEFTGLSKRQWSESK-----ELS-TMNRVVEDLLTKHR---FAY
A0A3Q2EDX8_MCL1-01      LISSFLRDFTGLPKQRRNQTK-----ALS-TMKRVVEDVLSKHR---YAY
A0A3Q2T2A9_MCL1-02      LISGFLRDFTGLSGHRWYTKK-----SLS-TMKRVVEDLLSKHR---YAY
A0A3Q2T2A9_MCL1-01      LISGFLRDFTGLSGHRWYTKK-----SLS-TMKRVVEDLLSKHR---YAY
A0A3B5PQ55_MCL1-02      LISSFLRDFTGLSKCRWGQNK-----ALS-TMKRVVEDLLSKHK---YAY
A0A3B5PQ55_MCL1-01      LISSFLRDFTGLSKCRWGQNK-----ALS-TMKRVVEDLLSKHK---YAY
A0A3P9Q4R7_MCL1-02      LISSFLRNFTGLSKCRWSQNK-----ALS-TMKRVVEDVLSKHR---YAY
A0A3P9Q4R7_MCL1-01      LISSFLRNFTGLSKCRWSQNK-----ALS-TMKRVVEDVLSKHR---YAY
A0A087X830_MCL1-01      LISSFLRNFTGLSKCRWSQNK-----ALS-TMKRVVEDVLSKHR---YAY
A0A3B3YCD0_MCL1-01      LISSFLRHFTGLSKCRWSQNK-----ALS-TMKRVVEDVLSKHR---YAY
A0A3P8VKS9_MCL1-02      LIFQFYRDFTTHSPSKWGERK-----ALT-TMKRVVDDVLEKHR---YAY
A0A3P8VKS9_MCL1-01      LIFQFYRDFTTHSPSKWGERK-----ALT-TMKRVVDDVLEKHR---YAY
A0A3P8VKS9_MCL1-05      LIFQFYRDFTTHSPSKWGERK-----ALT-TMKRVVDDVLEKHR---YAY
A0A3P8VKS9_MCL1-04      LIFQFYRDFTTHSPSKWGERK-----ALT-TMKRVVDDVLEKHR---YAY
A0A3P8VKS9_MCL1-03      LIFQFYRDFTTHSPSKWGERK-----ALT-TMKRVVDDVLEKHR---YAY
I3JHR5_MCL1-01          LIHSFLGDFTGLSQPQRKETK-----ALK-TMKRVVADVLEKHR---YAY
A0A3Q4HLQ8_MCL1-01      LIHSFLGDFTGLSQPQRKETK-----ALK-TMKRVVADVLEKHR---YAY
A0A3P8NP63_MCL1-02      LIHSFLGDFIGLSQPQRKETK-----ALK-TMKRVVADVLEKHR---YAY
A0A3P8NP63_MCL1-03      LIHSFLGDFIGLSQPQRKETK-----ALK-TMKRVVADVLEKHR---YAY
A0A3Q2VNL8_MCL1-01      LIHSFLGDFTGLSQPQRKETK-----ALK-TMKRVVADVLEKHR---YAY
A0A3P8NP63_MCL1-01      LIHSFLGDFIGLSQPQRKETK-----ALK-TMKRVVADVLEKHR---YAY
A0A3P9BVM3_MCL1-01      LIHSFLGDFIGLSQPQRKETK-----ALK-TMKRVVADVLEKHR---YAY
A0A3B4G4Z6_MCL1-01      LIHSFLGDFTGLSQPQRKETK-----ALK-TMKRVVADVLEKHR---YAY
A0A2U9CJ81_MCL1-01      LISQFLRDYVARTDPRWTDSK-----ALS-TMKRVVDRLVEKHR---YAY
A0A3Q3IZW0_MCL1-01      LICHFLRDYTGLSTHRWTRRK-----TLS-TMKRVVEGVLEKHR---YAY
A0A3Q1GX28_MCL1-02      LLSQFLQDFSGLTKPRWCETK-----ELS-TMKRVVNDVLEKHR---YAY
A0A3Q1GX28_MCL1-01      LLSQFLQDFSGLTKPRWCETK-----ELS-TMKRVVNDVLEKHR---YAY
A0A3B4XKA5_MCL1-01      LISQSMKSFTGRSIQRRTEHR-----ALQ-TMKRVVEGVLEKHR---YAY
A0A3Q3GP42_MCL1-01      LISAFLREHTGLSKPGWNESS-----ALS-TMKRVVEDVLAKHR---YAY
A0A3Q3M6G2_MCL1-02      LICQYLKDVSGLSKPRWHDSK-----ALS-TMKRVVEDLLEKYR---YTY
A0A3Q3M6G2_MCL1-01      LICQYLKDVSGLSKPRWHDSK-----ALS-TMKRVVEDLLEKYR---YTY
W5MMB7_MCL1-01          LIGTFLQMYTGLPHRR-SRGK-----ALE-TLKRVVDSVVAKHQ---IAY
A0A3B3R4U0_MCL1-01      LIGTFLRTYSGLPASA-SRHK-----AYP-VLRRVAETVIGKHL---IAY
A0A3B3SG34_MCL1-01      LITTFFAEYTGLCATLQRRNE-----ALS-TLKRVVATVVEKHK---FAY
Q4SW32_MCL1-01          LVSRLMADVTGISRAQWRESR-----ALA-TTKRVVGDLMEKHR---YTY
D2ITA0_MCL1-03          IIRIFLRDYAGASKAKRTRQD-----EVQVTMRRVVDGVLEKHQ---YAY
D2ITA0_MCL1-04          IIRIFLRDYAGASKAKRTRQD-----EVQVTMRRVVDGVLEKHQ---YAY
Q0KFR9_MCL1-01          LIENFLGDYTGLSQPRWTQSK-----PLT-TMKRVVEDVIAKHR---YAY
A0A3P8Y1W8_MCL1-01      LIENLLRDYTGLSQPRWKQNK-----SLV-TMKRVVGDVIAKHT---YAY
A0A3P8Y1W8_MCL1-02      LIENLLRDYTGLSQPRWKQNK-----SLV-TMKRVVGDVIAKHT---YAY
A0A3Q2XZL8_MCL1-01      LIRRFLTDFTGLSTASWNESK-----AHS-TMKRVVAKVLEKHK---YKY
A0A3B4AFB7_MCL1-02      LLSDFFKLFTGISQPKWKQRP-----ALS-TMKGVVDKLLEKHR---YAY
A0A3B3VM25_MCL1-01      LIGSFLRNFTGLSKCRWSQNK-----ALS-TMKRVVEDVLSKHR---YAY
A0A3Q0RA11_MCL1-03      LITSFFRDFTGLSQRRWKESE-----ALK-TMKRVVADVLEKHR---YAY
A0A3Q0RA11_MCL1-01      LITSFFRDFTGLSQRRWKESE-----ALK-TMKRVVADVLEKHR---YAY
A0A3B4T8L9_MCL1-02      LISQSMKSFTGRSIPRWTEHR-----ALQ-TMKRVVDGVLEKHR---YAY
A0A3B4T8L9_MCL1-01      LISQSMKSFTGRSIPRWTEHR-----ALQ-TMKRVVDGVLEKHR---YAY
A0A3Q1EQB9_MCL1-02      LIRRFLRDFTGLSKPRWNESK-----ALS-TMKRVVDDVLDKHR---YSY
A0A3B4ZKP6_MCL1-01      LISSFLKDFTGLSKPRWNEGK-----ALS-TMKRVVEDVLEKHR---YAY
A0A3Q1BKL8_MCL1-02      LLRRFLRDFTGLSKPRWNESK-----ALS-TMKRVVDDVLDKHR---YAY
A0A3Q1EQB9_MCL1-01      LIRRFLRDFTGLSKPRWNESK-----ALS-TMKRVVDDVLDKHR---YSY
A0A3Q1BKL8_MCL1-01      LLRRFLRDFTGLSKPRWNESK-----ALS-TMKRVVDDVLDKHR---YAY
A0A3P8RQX7_MCL1-02      LLRRFLRDFTGLSKPRWNESK-----ALS-TMKRVVDDVLDKHR---YAY
A0A3P8RQX7_MCL1-01      LLRRFLRDFTGLSKPRWNESK-----ALS-TMKRVVDDVLDKHR---YAY
U3JTB2_BCL2A1-01        -----------------PAQT-----RVAHVLRTMASSLQDQTE---EAL
H0ZCL9_BCL2A1-01        -----------------PAQT-----RVAHVLRTMASSLQDQTE---EAV
Q9W6F2_BCL2A1-01        -----------------PAQT-----RVAHVLRNIASSLQDQTE---EAL
G1N8C5_BCL2A1-01        -----------------PAQT-----RVAHVLRNIASSLQDQTE---EAL
A0A452J3N6_BCL2A1-      -----------------PAPS-----RVAHVLRHAASFLQKENE---ESL
K7G130_BCL2A1-01        -----------------PAPS-----RVAHVLRNSASFLQKENE---EIL
F6SFL4_BCL2A1-01        -----------------SCLN-----KTSQILQKVAFSVQQEVE---KDM
G3WSP8_BCL2A1-01        -----------------SCLH-----RTSQILQKVAFSVQEEVE---KDM
F6S8G3_BCL2A1-01        -----------------TVPS-----RTSRALQNVMFSVQGDVE---KAL
G1T1L8_BCL2A1-01        -----------------LGPS-----KTSRVLQNVTFSIQQEVE---EAL
O55178_BCL2A1-01        -----------------SAPS-----QAFRVLQRVAFSVQKEVG---KNL
Q0P538_BCL2A1-01        -----------------SAPS-----QAFRVLQRVAFSVQKEVG---KNL
A0A337STN9_BCL2A1-      -----------------SHPS-----RVSQVLQDVAFSVQGEVE---KKL
A0A337STN9_BCL2A1-      -----------------SHPS-----RVSQVLQDVAFSVQGEVE---KKL
E2RS00_BCL2A1-01        -----------------PAPS-----RASRVLQDVAFSVQGQVE---KNL
M3YVH4_BCL2A1-01        -----------------PAAS-----RVSRVLRDVASSVQGEVE---QNL
A0A452SIR9_BCL2A1-      -----------------SAPS-----RASQVLRDVASSVQGEVE---KNL
G3V977_BCL2A1-01        -----------------SAPS-----KTSRVLQRVAFSVQKEVE---KNL
Q925A9_BCL2A1-01        -----------------SAPS-----KTSRVLQRVAFSVQKEVE---KNL
Q07440_BCL2A1-01        -----------------SAPS-----QACRVLQRVAFSVQKEVE---KNL
O55179_BCL2A1-01        -----------------SAPS-----QACRVLQRVAFSVQKEVE---KNL
O55177_BCL2A1-02        -----------------SAPS-----QACRVLQRVAFSVQKEVE---KNL
Q497M6_BCL2A1-01        -----------------SAPS-----KACRVLQRVAFSVQKEVE---KNL
Q8K164_BCL2A1-01        -----------------SAPS-----QACRVLQRVAFSVQKEVE---KNL
Q4FK02_BCL2A1-01        -----------------SAPS-----KACRVLQRVAFSVQKEVE---KNL
I3MCZ7_BCL2A1-01        -----------------SSPS-----KTSKVLQNVAFSVQKEVE---KNL
G3T8E6_BCL2A1-01        -----------------AGSS-----KTSRVLQNVAFSVQKEVE---KNL
H0WZ23_BCL2A1-01        -----------------SGPS-----KTSRVLQNVAFSVQEEVE---KSL
A0A2K6TLM0_BCL2A1-      -----------------TGPS-----KTSRVLQKVAFSVQKEVE---ESL
A0A2K5D2I1_BCL2A1-      -----------------TGPS-----KTSRVLQKVAFSVQKEVE---KSL
U3DBA0_BCL2A1-02        -----------------MGPS-----KTSRVLQQVAFSVQKEVE---KSL
A0A2K6TLM0_BCL2A1-      -----------------TGPS-----KTSRVLQKVAFSVQKEVE---ESL
B4E1X9_BCL2A1-01        -----------------SGPS-----KTSRVLQNVAFSVQKEVE---KNL
Q16548_BCL2A1-02        -----------------SGPS-----KTSRVLQNVAFSVQKEVE---KNL
A0A2I2YML2_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2R8ZJX9_BCL2A1-      -----------------SGPS-----QTSRVLQNVAFSVQKEVE---KNL
A0A2I3T6T8_BCL2A1-      -----------------SGPS-----KTSRVLQNVAFSVQKEVE---KNL
A0A2I3HNF3_BCL2A1-      -----------------SGPS-----KTSRVLQNVAFSVQKEVE---KNL
A0A2K6PHG5_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K6LV22_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
F7E8V5_BCL2A1-02        -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K5KHH9_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K6AD55_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K5TMD8_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K5KAB6_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQEEVE---KNL
A0A2K6DS80_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A096NMX5_BCL2A1-      -----------------LGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K6EKG1_BCL2A1-      -----------------SGPS-----KTSRVLQNIAFSVQNEVE---KNL
Q3C2I0_BCL2A1-01        -----------------SKPS-----KTSRVLQDVASSVQDEVE---RTL
A0A452EK63_BCL2A1-      -----------------SKPS-----KTSRVLQDVASSVQDEVE---RTL
W5Q0N6_BCL2A1-01        -----------------SKPS-----KTSRVLQDVASSVQDEVE---RTL
F7CP56_BCL2A1-01        -----------------SGPS-----KTSRVLQDIAFSVQNEVE---KNL
C7F841_BCL2A1-02        -----------------SGPS-----KTSRVLRDVAFSVQNEVE---KNL
C7F841_BCL2A1-01        -----------------SGPS-----KTSRVLRDVAFSVQNEVE---KNL
A0A2I3HNF3_BCL2A1-      -----------------SGPS-----KTSRVLQNVAFSVQKEVE---KNL
A0A2I2YML2_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2R8ZJX9_BCL2A1-      -----------------SGPS-----QTSRVLQNVAFSVQKEVE---KNL
A0A2I3T6T8_BCL2A1-      -----------------SGPS-----KTSRVLQNVAFSVQKEVE---KNL
H2NNZ9_BCL2A1-01        -----------------SGPS-----KASRVLQKVAFSVQKEVE---KNL
Q16548_BCL2A1-01        -----------------SGPS-----KTSRVLQNVAFSVQKEVE---KNL
A0A2I2YML2_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K6LV22_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K6PHG5_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2R8ZJX9_BCL2A1-      -----------------SGPS-----QTSRVLQNVAFSVQKEVE---KNL
A0A2I3T6T8_BCL2A1-      -----------------SGPS-----KTSRVLQNVAFSVQKEVE---KNL
A0A2I3HNF3_BCL2A1-      -----------------SGPS-----KTSRVLQNVAFSVQKEVE---KNL
A0A2K5KHH9_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K5KHH9_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K5KAB6_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQEEVE---KNL
A0A2K5TMD8_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
F7E8V5_BCL2A1-01        -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K6DS80_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A2K6AD55_BCL2A1-      -----------------SGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A096NMX5_BCL2A1-      -----------------LGPS-----KTSRVLQKVAFSVQKEVE---KNL
A0A0D9RRC3_BCL2A1-      -----------------SGPS-----KTSRVLQKVASSVQKEVE---KNL
A0A2K5D2I1_BCL2A1-      -----------------TGPS-----KTSRVLQKVAFSVQKEVE---KSL
U3DBA0_BCL2A1-01        -----------------MGPS-----KTSRVLQQVAFSVQKEVE---KSL
A0A2K6TLM0_BCL2A1-      -----------------TGPS-----KTSRVLQKVAFSVQKEVE---ESL
R4JQR8_BCL2L1-01        -----------------DLPP-----SQIQLKLRSLGDEFQERF---QTQ
A0A346RRN1_BCL2L1-      -----------------EVPP-----SQVQLTLRTIGDEFQERF---RTQ
Q99M66_BCL2L10-01       -----------------PLPT-----SVEAALLRSVTSQIQQEH---QDL
F6ZPD4_BCL2L10-01       ----------------------------EVAVLRCVAAQIQPRN---QRV
Q9Z0F3_BCL2L10-01       -----------------PPPT-----SVEAALLRSVTRQIQQEH---QEF
E1B9B3_BCL2L10-01       -----------------PAPS-----TPEAAVLRHVAARIQEAN---RNV
F1RZB9_BCL2L10-01       -----------------RQPS-----SPEAAVLRCVAAQIREYN---VRT
G1T264_BCL2L10-01       -----------------PQPS-----TPEAAVLRCAATQLQRVH---WPF
F1MV39_BCL2L10-01       -----------------PAPS-----TPEAAVLRHVAARIQEAN---RNV
W5QIG4_BCL2L10-01       -----------------PAPS-----TPEAAVLRHVAARVLEAN---RNV
A0A2K6F2Q2_BCL2L10      -----------------LPPS-----SLEAAAMRFAATKIRRKH---ASF
H0WZ06_BCL2L10-01       -----------------PTPS-----SPEAALLRSVTAYIQQRH---WSF
A0A2K6TIT7_BCL2L10      -----------------SPPA-----TAEAAVLRATAAVVRKLY---PSF
A0A2K5F974_BCL2L10      -----------------SPPS-----TAEAAVLRAMAAGVRKLY---RSF
F7CT87_BCL2L10-01       -----------------SPPS-----TAEAAVLRAVAASVRKLY---RSF
A0A0D9RG38_BCL2L10      -----------------PRPS-----TPEAAVLRSAAARLRQLH---RSF
A0A096NM44_BCL2L10      -----------------PRPS-----TPEAAVLRSAAARLRQLH---RSF
A0A2K6R5T5_BCL2L10      -----------------PRPS-----TPEAAVLRSAAARLRQLH---RSF
Q9HD36_BCL2L10-02       -----------------PAPS-----TPEAAVLRSAAARLRQIH---RSF
G1R3W6_BCL2L10-01       -----------------PTPS-----TPEAAMLRSAAARLRQLH---PSF
A0A2K5K3B0_BCL2L10      -----------------PRPS-----TPEAAVLRSAAARLRQLH---RSF
A0A2K6M5H5_BCL2L10      -----------------PRPS-----TPEAAVLRSAAARLRQLH---RSF
A0A2K5TKG9_BCL2L10      -----------------PRPS-----TPEAAVLRSAAARLRQLH---RSF
F7H6U5_BCL2L10-01       -----------------PRPS-----TPEAAVLRSAAARLRQLH---RSF
A0A2K6B2D9_BCL2L10      -----------------PRPS-----TPEAAVLRSAAARLRQLH---RSF
A0A2K5MMZ4_BCL2L10      -----------------PRPS-----TPEAAVLRSAAARLRQLH---RSF
H2NN92_BCL2L10-01       -----------------PTPP-----TPEAAVLRSAAARLRQLH---RSF
G3QLU6_BCL2L10-01       -----------------PTPS-----TPEAAVLRSAAARLRQIH---RSF
A0A2R9BCD9_BCL2L10      -----------------PTPS-----TPEAAVLRSAAARLRQIH---RSF
H2Q9G4_BCL2L10-01       -----------------PTPS-----TPEAAVLRSAAARLRQIH---RSF
Q9HD36_BCL2L10-01       -----------------PAPS-----TPEAAVLRSAAARLRQIH---RSF
A0A337RYG8_BCL2L10      -----------------RTPS-----TPEAAVLRYLAAQIRQRH---QRF
G1LKR4_BCL2L10-01       -----------------RAPS-----TPEAAVLRSVAAQVQQRH---ERF
A0A452QJG0_BCL2L10      -----------------RAPS-----TPEAAVLRSVAAQVQQRH---EHF
P70345_BCL2L2-03        -------------------ME-----------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------VEELFRDG--VN
A0A3Q0RA11_MCL1-02      -------------GMVNKL-SL---DERGEDVTFVSAVAKSLFADKT-TN
I3KXG5_MCL1-01          N------------GMINKL-SL---DEREEDMSF---VAKSLFGDHT-TN
U3KKY6_MCL1-01          P------------GMLRKL-EI----QQEEDLQSVVEVAAHVFSDGV-TN
G1MPY7_MCL1-01          S------------GMLRKL-EI----KKEEDLQAVCEVAAHVFSDGV-TN
K7FPN7_MCL1-01          -------------GMLRKL-DI----KNEEDLKSVSSVATHVFSDGI-TN
F6VJQ0_BCL2L10-01       E------------CALNQL-LD---REPE----QVIVNVAELMDRGE-FN
A0A3Q1GS47_BCL2L1-      S------------DLHSQL-HI---TPAT-AYQSFENVMDEVFRDGV--N
A0A2K5DMS4_MCL1-01      Q------------GMLRNL-DN---KNED-NVKSFY---------GV-TN
A0A3P8V8T6_MCL1-01      S------------GMINNL-SF---ENGVYNIGVVGAVARSLFRDGT-SN
B6V6J0_MCL1-01          T------------GMLQRL-SI---HSRE-DLQKLSEVPALVFNDGV-TN
F7ETY1_MCL1-01          T------------GMLQRL-SI---HSRE-DLQKLSEVPALVFNDGV-TN
A0A287APJ6_BCL2-01      P------------PDTDTP-GF---AEEN-KTKPLETRLISE-TTSV-CK
H3AR18_MCL1-01          N------------GMQQKL-NI---HKED-DLHIIPEIGNQIFKDGA-TN
F7G4L5_BCL2L2-04        S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2K6GWN0_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2R8M4C0_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2K5CWZ4_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2I2YPX6_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2K6TM77_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
W5QDH5_BCL2L2-01        S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
D3Z5F7_BCL2L2-01        S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2K6MEE6_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2K6RW46_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A384DPS8_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2K5MZX9_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2K5HEK7_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2K5V0Q3_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
F7G4L5_BCL2L2-05        S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2K6EA73_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2K6AI30_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
G1RYB4_BCL2L2-01        S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2R9A7B2_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
H2Q805_BCL2L2-02        S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A2I3MUE4_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A287AW74_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
A0A384DPS8_BCL2L2-      S------------DLAAQL-HV---TPGS-AQQRFTQVSDELFQGGP--N
J7H260_MCL1-01          Q------------GMLQKL-SI---QRPE-DIQKLSEVPSMVFSDGV-TN
H0XHA5_MCL1-01          -------------------------------INSLSRVMAHVFSYGV-TN
R4GAJ0_MCL1-01          Q------------GMLRKL-EI---KKEE-DLASVAEVTTEVFRDGI-IN
R4GAJ0_MCL1-02          Q------------GMLRKL-EI---KKEE-DLASVAEVTTEVFRDGI-IN
G1QAV8_MCL1-01          L------------GML-EL-DT---ENED-NVKSSSQAMVHAFRDGV-TN
A0A2K6F6N9_MCL1-01      Q------------GMLQKL-DI---KNED-DVKSLSRVMVHVFSDSV-TN
M3XAP4_MCL1-03          Q------------GMLRKL-DI---KNEN-DVKSLSRVMVHVFSDGV-TN
A0A2K6GI15_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
C8YZ26_MCL1-01          Q------------GMLRRL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
A0A2K5CFH3_MCL1-02      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
F7GTF7_MCL1-03          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K6V5Y3_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K5LXU8_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K5I9Q7_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
A0A2I2YQH7_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
Q07820_MCL1-04          Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
A0A2K5W0W9_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
F7HUE9_MCL1-02          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K6ECR0_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K5XSC7_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2R9BYH6_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
K7DE58_MCL1-03          Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
A0A2I3M3D6_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K6KRW9_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K6PPL1_MCL1-03      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
K7DE58_MCL1-04          -------------CMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
A0A2I3GB35_MCL1-03      -------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
G2HFR3_MCL1-01          -------------TIHMLL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
A0A1L1RNM6_MCL1-01      Q------------GMLRKL-EI---KKED-DLQAVCEVAAHVFNDGV-TN
A0A1L1RNM6_MCL1-02      Q------------GMLRKL-EI---KKED-DLQAVCEVAAHVFNDGV-TN
F6ZMX1_MCL1-01          Q------------GMLRKL-DI---KNEE-DIKAVSRVATHVFSDGI-TN
A0A286Y1M5_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVVALVFSDGV-TN
P97287_MCL1-02          Q------------GMLRKL-DI---KNEG-DVKSFSRVMVHVFKDGV-TN
P97287_MCL1-01          Q------------GMLRKL-DI---KNEG-DVKSFSRVMVHVFKDGV-TN
G3T756_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMAHVFSDGI-TN
G1L3M8_MCL1-02          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2U3V2H3_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
K9IWB2_MCL1-03          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
K9IWB2_MCL1-02          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
K9IWB2_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
B4DU51_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
A0A287DCH9_MCL1-02      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A287DCH9_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A452GAH0_MCL1-02      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K5I9Q7_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
G1PZ39_MCL1-01          Q------------GERGPR----------------------ALCLVR-DR
Q95KR3_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVLSDGV-TN
A0A2K5EPY9_MCL1-02      --------------MLRKL-DI---KNKD-DVKSLSRVMVHVFSDGV-TN
A0A2K5EPY9_MCL1-01      P------------GMLRKL-DI---KNKD-DVKSLSRVMVHVFSDGV-TN
J9PBC4_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVIVHVFSDGV-TN
A0A2K5C7L5_MCL1-01      Q------------V---------------------------LPCRRP-RR
Q9Z1P3_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSFSRVMTHVFKDGV-TN
A5PJR2_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A452GAH0_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
G1L3M8_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
F7AVA6_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMAHVFSDGV-TN
G1T2Q0_MCL1-02          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
G1T2Q0_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
M3XAP4_MCL1-01          Q------------GMLRKL-DI---KNEN-DVKSLSRVMVHVFSDGV-TN
Q7YRZ9_MCL1-01          Q------------GMLRKL-DI---KNEN-DVKSLSRVMVHVFSDGV-TN
J9PBC4_MCL1-02          Q------------GMLRKL-DI---KNED-DVKSLSRVIVHVFSDGV-TN
Q8HYS5_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVIVHVFSDGV-TN
M3XZZ5_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A452RHX5_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
H0XFB7_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K6GI15_MCL1-02      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
F7GTF7_MCL1-02          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K5CFH3_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K6V5Y3_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K6KRW9_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K6PPL1_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K5XSC7_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A0D9RZP5_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K5W0W9_MCL1-02      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
I7G687_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
F7HUE9_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K6ECR0_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2I3M3D6_MCL1-02      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2K5LXU8_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
A0A2I3GB35_MCL1-02      Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
H2N5Y9_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
Q07820_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
A0A2R9BYH6_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
K7DE58_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
A0A2I2YQH7_MCL1-01      Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
A0A2K5I9Q7_MCL1-02      Q------------GWVCGV----------------------LPCRGP-RR
M3XAP4_MCL1-02          Q------------GWVCGV----------------------LPCRGP-RR
A0A2K6GI15_MCL1-01      Q------------GWVCGV----------------------LPCRGP-RR
F7GTF7_MCL1-01          Q------------GWVCGV----------------------LPCRGP-RR
A0A2K5CFH3_MCL1-03      Q------------GWVCGV----------------------LPCRGP-RR
A0A2K6V5Y3_MCL1-02      Q------------GWVCGV----------------------LPCRGS-RR
A0A2K6KRW9_MCL1-02      Q------------GWVCGV----------------------LPCRGP-RR
A0A2K6PPL1_MCL1-02      Q------------GWVCGV----------------------LPCRGP-RR
A0A2K5LXU8_MCL1-02      Q------------GWVCGV----------------------LPCRGP-RR
A0A2K5W0W9_MCL1-01      Q------------GWVCGV----------------------LPCRGP-RR
A0A2K6ECR0_MCL1-02      Q------------GWVCGV----------------------LPCRGP-RR
A0A2I3M3D6_MCL1-01      Q------------GWVCGV----------------------LPCRGP-RR
A0A2K5XSC7_MCL1-02      Q------------GWVCGV----------------------LPCRGP-RR
A0A2I3GB35_MCL1-01      Q------------GWVCGV----------------------LPCRGP-RR
Q07820_MCL1-03          Q------------GWVCGV----------------------LPCRGP-RR
A0A2R9BYH6_MCL1-02      Q------------GWVCGV----------------------LPCRGP-RR
K7DE58_MCL1-02          Q------------GWVCGV----------------------LPCRGP-RR
A0A2I2YQH7_MCL1-02      Q------------GWVCGV----------------------LPCRGP-RR
G3WBC5_MCL1-01          Q------------GMLRKL-DI---KNEE-DIKAVSRVVTHVFSDGV-TN
W5QI41_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMVHVFSDGV-TN
F1MQX4_MCL1-01          Q------------GMLQKL-DI---KNED-DVKSLSRVMVHVFSDRV-TN
B4DLY8_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
B4DG83_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDGV-TN
B4E3L8_MCL1-01          Q------------GMLRKL-DI---KNED-DVKSLSRVMIHVFSDSV-TN
F8W4Q8_MCL1-02          S------------GMIARL-NL---EQKGEDVSFIKQVATELFSDGT-TN
G1QEX2_BCL2L10-01       S------------------------RRQRNRLEQMVDQIESLVPDGTDPN
H3AAS7_BCL2L2-02        N------------SLSSHL-HI---TPG-TAYRRFAETADSLFQDG--VN
H3AAS7_BCL2L2-01        N------------SLSSHL-HI---TPG-TAYRRFAETADSLFQDG--VN
F6TEC3_BCL2L2-01        S------------EISTQI-HV---TPG-TAYARFAEVAGSLFQGG--VN
G1Q051_BCL2L2-01        S------------DLVAQL-HV---TPG-SAQQCFTQVSDELFQGG--PN
G3WPT2_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--AN
P70345_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
O88996_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A3Q9B4M8_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
H0XR82_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
Q92843_BCL2L2-02        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
Q05KI8_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
Q1RMX3_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
Q45T69_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A452ECF0_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A286XQQ9_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K5MZX9_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A0D9RU30_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K5HEK7_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
F6PH48_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2I2UAE3_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2I2YPX6_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
I3ND50_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K5V0Q3_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
F7G4L5_BCL2L2-02        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
F7G4L5_BCL2L2-03        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K6EA73_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K6AI30_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
G1RYB4_BCL2L2-03        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2R9A7B2_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
H2Q805_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2I3MUE4_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K6GWN0_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K6MEE6_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K6RW46_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K6RW46_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K6TM77_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A287AW74_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2U4CFE3_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A452SHI1_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A384DPS8_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
F6U940_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
G3WPT2_BCL2L2-02        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--AN
W5QDH5_BCL2L2-02        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
Q7TS60_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
G1LMC3_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
M3Y5X5_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
G1P3J2_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
I3ND50_BCL2L2-02        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
P70345_BCL2L2-04        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
Q6GLI5_BCL2L1-01        S------------DLTAQL-HL---TQD-TAQQSFQQVVGELFRDG--TN
Q2TAP5_BCL2L1-01        S------------DLTSQL-HI---TQD-TAQQSFQQVMGELFRDG--TN
Q91828_BCL2L1-01        S------------DLTSQL-HI---TQD-TAQQSFQQVMGELFRDG--TN
I7GKS6_BCL2L1-01        R------------PPVPSM-ATHPGTPG-TAYQSFEQVVNELFRDG--VN
A0A2K5EBP4_BCL2L1-      R------------PPVPSM-LHI--TPG-TAYQSFEQVVNELFRDG--VN
A0A2K6UWY8_BCL2L1-      R------------PPVPSM-LHI--TPG-TAYQSFEQVVNELFRDG--VN
A0A3Q1LRT3_BCL2L1-      S------------DLMSQL-RI---TPG-TACQSFEQVINELFRDR--VK
A0A2K5M8B1_BCL2L1-      R------------PPVPSM-AT---HPG-TAYQSFEQVVNELFRDG--VN
A0A2K5H963_BCL2L1-      R------------PPVPSM-AT---HPG-TAYQSFEQVVNELFRDG--VN
G3RY91_BCL2L1-02        R------------PPVPSM-AT---HPG-TAYQSFEQVVNELFRDG--VN
A0A2K5VPG2_BCL2L1-      R------------PPVPSM-AT---HPG-TAYQSFEQVVNELFRDG--VN
F6UKR4_BCL2L1-02        R------------PPVPSM-AT---HPG-TAYQSFEQVVNELFRDG--VN
A0A2K5YR37_BCL2L1-      R------------PPVPSM-AT---HPG-TAYQSFEQVVNELFRDG--VN
A0A2K6LPM4_BCL2L1-      R------------PPVPSM-AT---HPG-TAYQSFEQVVNELFRDG--VN
A0A2K6QFA2_BCL2L1-      R------------PPVPSM-AT---HPG-TAYQSFEQVVNELFRDG--VN
A0A2K6G3C5_BCL2L1-      R------------PPVPLM-AT---HPG-TAYQSFEQVVNELFRDG--VN
H9GHK7_BCL2L1-01        S------------DLTSQL-HI---TLG-TAYQSFEQVVNELFHDG--VN
Q07816_BCL2L1-04        R------------GERGQG-DA---GTG-GTHCVLDDHVLDRPSRS--LD
Q07817_BCL2L1-02        S------------DLTSQL-HI---TPG-TAYQSFEQ-------------
A0A2K5YR37_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQ-------------
A0A452E1B1_BCL2L1-      S------------DLTSQL-HI---TPG-TTYQSFEQVINELFQDG--VN
W5PSA5_BCL2L1-01        S------------DLTSQL-HI---TPG-KAYQSFEQVINELFQDG--VN
Q07816_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFHDG--VN
Q07816_BCL2L1-03        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFHDG--VN
Q07816_BCL2L1-02        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFHDG--VN
G1N5N5_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFHDG--VN
A0A452ILL8_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A452ILL8_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
K7F655_BCL2L1-01        S------------DLTSQL-HI---TLG-TAYQSFEQVVNELFRDG--VN
A0A287CZ07_BCL2L1-      S------------DLTSQL-HI---TLG-TAYQSFEQVVNELFRDG--VN
F6WA14_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
G3WKX6_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
F6WQI0_BCL2L1-02        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
G3SPN0_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
H0X6V2_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q2PFS6_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
P53563_BCL2L1-02        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
P53563_BCL2L1-03        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
O35843_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
G1RER8_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q64373_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q64373_BCL2L1-09        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
P53563_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2U3V0P1_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
O77737_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVLNELFRDG--VN
Q9MYW4_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
F6WQI0_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
B2Z3Z4_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q05KJ0_BCL2L1-02        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q05KJ0_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
E2IV76_BCL2L1-01        S------------DLTSQL-HI---TLG-TAYQSFEQVVNELFRDG--VN
A0A2K6G3C5_BCL2L1-      S------------DLTSQL-HI---TLG-TAYQSFEQVVNELFRDG--VN
M3Z2H9_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A0D9RJZ8_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A286Y5D6_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A1L5BWY3_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
I3MUP5_BCL2L1-03        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
I3MUP5_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
I3MUP5_BCL2L1-02        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
G1P9D2_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2K5EBP4_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
E2IV75_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
F7IT34_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
F7IT34_BCL2L1-02        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q76LT7_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2K5M8B1_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2K5H963_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
M3XA94_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q8SQ42_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
G3RY91_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q07817_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q07817_BCL2L1-03        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2K5VPG2_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
F6UKR4_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2K5YR37_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2J8VIH3_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2K6LPM4_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2K6QFA2_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2K6QFA2_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A2K6UWY8_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
E2IV77_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A452SDS4_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A384D3U1_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A452FWV3_BCL2L1-      S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q9MZS7_BCL2L1-01        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q64373_BCL2L1-03        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
Q64373_BCL2L1-04        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
P53563_BCL2L1-04        S------------DLTSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
A0A3B1IEV7_MCL1-01      N------------GMVQKL-NL---EEQDDSMDIISSVAKALFSDGT-TN
A0A3B4E3I4_MCL1-03      N------------GMVQRL-CL---EQQDDSMEFISSVAKTLFNDGT-TN
A0A3B4E3I4_MCL1-02      S------------GMVQRL-CL---EQQDDSMEFISSVAKTLFDDGI-TN
A0A3B4E3I4_MCL1-01      S------------GMVQRL-CL---EQQDDSMEFISSVAKTLFNDGT-TN
A0A3Q3B0R2_BCL2-01      V------------EMSRQL-GL---ASA-AAKARFAEVMDELFRDG--VN
A0A3Q2PN77_BCL2-01      A------------EMSQQL-YI---TRD-TARTRFAEVVDELFRDG--VN
A0A1X9JZA1_BCL2-01      T------------EMSRQL-YL---TST-TAQRRFADVIDELFRDG--VN
A0A3Q0S5Z7_BCL2-01      T------------EMSRQL-HL---TSA-TAQRRFAEVIDELFRDG--VN
A0A3P8QVM8_BCL2-01      T------------EMSRQL-HL---TSS-TAQRRFAEVIDELFRDG--VN
A0A3P9DIG5_BCL2-01      T------------EMSRQL-HL---TSS-TAQRRFAEVIDELFRDG--VN
A0A3Q2UYW8_BCL2-01      T------------EMSRQL-HL---TSA-TAQRRFAEVIDELFRDG--VN
A0A3B4G3K4_BCL2-01      T------------EMSRQL-HL---TSA-TAQRRFAEVIDELFRDG--VN
A0A3Q1I5N1_BCL2-01      T------------EMSRQL-YL---TST-TAQRRFAEVIDELFRDG--VN
A0A3Q3K1K1_BCL2-01      T------------EMSRQL-HL---TST-TAQRRFAEVIDELFRDG--VN
A0A3Q3MEY1_BCL2-01      T------------EMSRQL-YL---TST-TAQRRFAEVIDELFRDG--VN
A0A3Q1FLK7_BCL2-01      T------------EMSRQL-YL---TTT-TAQRRFAEVIDELFRDG--VN
A0A3Q1B8C3_BCL2-01      T------------EMSRQL-YL---TST-TAQRRFAEVIDELFRDG--VN
A0A3P8S9L3_BCL2-01      T------------EMSRQL-YL---TST-TAQRRFAEVIDELFRDG--VN
A0A3B5BBQ0_BCL2-01      T------------EMSRQL-YL---TST-TAQRRFAEVIDELFRDG--VN
A0A3B4TX71_BCL2-01      T------------EMSRQL-YL---TST-TAQRRFAEVIDELFRDG--VN
A0A3B4YAG2_BCL2-01      T------------EMSRQL-YL---TST-TAQRRFAEVIDELFRDG--VN
A0A286XUI2_BCL2A1-      K------------PWLDRI-DV---ESIDTAKSIFNQVMEKEFEDGI-IN
Q564A4_BCL2-01          E------------EMSQQM-VF---NPN-SAQRSFLTVAEELFRDG--VN
W5N4F7_BCL2-01          A------------EMSDQL-HF---TPN-TARRKFTAVVEELFRDG--VN
A0A3Q4MN81_BCL2L10      D------------NLAQTF-LV---QCGPDHCLSLRKVMKELVGDGH-LN
A0A3B4ETX9_BCL2L10      D------------NLAQTF-LV---QCGPDHCLSLRKVMKELVGDGH-LN
D2IT42_BCL2L10-02       Q------------ALAQSF-LA---QCEADACAGLRKVMEELVGDGQ-LN
A0A3Q0S9R1_BCL2L10      D------------NLAQTF-LR---HCGPDHCSSLRKVMEELVGDGH-LN
I3J363_BCL2L10-01       D------------NLAQTF-LV---QCGPDHCLSLRKVMKELVGDGH-LN
A0A3Q2UUP0_BCL2L10      D------------NLAQTF-LV---QCGPDHCLSLRKVMKELVGDGH-LN
A0A3P8PVZ8_BCL2L10      D------------NLAQTF-LV---QCGPDHCLSLRKVMKELVGDGH-LN
A0A3Q2UUP0_BCL2L10      D------------NLAQTF-LV---QCGPDHCLSLRKVMKELVGDGH-LN
A0A3P9BLI0_BCL2L10      D------------NLAQTF-LV---QCGPDHCLSLRKVMKELVGDGH-LN
A0A3Q2PJS5_BCL2L10      H------------ALAQSF-LR---HSQTDLCTSLWKVMDEMVGDGH-FN
A0A3Q2GL87_BCL2L10      H------------TLAQSF-LR---HSGTDLCSSLRKVMDEMVGDGL-FN
A0A3B5MJ12_BCL2L10      H------------SLAQGF-LK---HCGSDLCSNLRKVMDEMVGDGH-FN
M4AUW7_BCL2L10-01       H------------SLAQGF-LK---HCGSDLCSNLRKVMDEMVGDGH-FN
A0A096ME02_BCL2L10      H------------SLAQGF-LK---HCGTDLCSNLRKVMDEMVGDGH-FN
A0A3B3TYN4_BCL2L10      H------------SLAQGF-LK---HCGTDLCSNLRKVMDEMVGDGH-FN
A0A3B3YT99_BCL2L10      H------------SLAQGF-LK---HCGTDLCSNLRKVMDEMVGDGH-FN
A0A3P9NE65_BCL2L10      H------------SLAQGF-LK---HCGTDLCSNLRKVMDEMVGDGH-FN
A0A3P9LM07_BCL2L10      S------------TLAQNF-RK---HSGPDLCSSLRKVMEELVGDER-LN
H2MBQ3_BCL2L10-01       S------------TLAQNF-RK---HSGPDLCSSLRKVMEELVGDER-LN
A0A3B4AAV4_BCL2L10      H------------SLSQTF-LK---QCGPDPCSSLRKVMEELVGDGH-LN
A0A3Q3EZU5_BCL2L10      Q------------SLAQTF-LR---QCGPDPCSGLRKVMEELVGDGH-LN
A0A3Q3EZU5_BCL2L10      Q------------SLAQTF-LR---QCGPDPCSGLRKVMEELVGDGH-LN
A0A3Q3JQ78_BCL2L10      H------------SLAQTF-LK---QCGPDPCSSLRKVMEELVGDGH-LN
A0A3B4TIY6_BCL2L10      H------------TLAQTF-VT---QCGLDPCSSLRKVMEELVGDGH-LN
A0A3B4WGF4_BCL2L10      H------------TLAQTF-VT---QCGLDPCSSLRKVMEELVGDGH-LN
A0A3Q3KZW1_BCL2L10      H------------SLTQTF-LK---QCGPDPCSSLRKVIEELVADGH-LN
A0A3B5KD08_BCL2L10      N------------SLAQTF-LR---QCGPDLCSSLRKVMEELVGDGH-LN
A0A3Q3VI28_BCL2L10      H------------SLAQTF-LR---QCGTDPCSSLRNVMEELVGDGH-LN
A0A3Q1GM98_BCL2L10      H------------SLTQAF-LR---QCGPDFCSSLRMVMEELVEDGH-LN
A0A3Q1D2L0_BCL2L10      H------------SLTQTF-LR---QCGPDLCSSLRKVMEELVGDGH-LN
A0A3P8RL82_BCL2L10      H------------SLTQTF-LR---QCGPDLCSSLRKVMEELVGDGH-LN
A0A3B4ZFS0_BCL2L10      H------------SLTQTF-LR---QPGPDLCSSLRRVMEELVGDGH-LN
A0A3B4AFB7_MCL1-01      N------------GMINKL-AL---DDRGDDVSFIGTVAKSIFEDGT-TN
B9ZYL7_BCL2-01          R------------QISGLL-HL---TPS-TVRVRFATVVEELFHDG--VN
A0A452I9V7_BCL2-01      A------------QMSGQL-HL---TPF-TARGRFVAVVEELFRDG--VN
H9GPE7_BCL2-01          A------------QMSGQL-HL---TPS-TARSRFVAVVEELFQDG--VN
A0A3Q2HRY3_BCL2-02      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
K7F5Y4_BCL2-02          A------------QMSGQL-HL---TPF-TARGRFVAVVEELFRDG--IN
K7F5Y4_BCL2-01          A------------QMSGQL-HL---TPF-TARGRFVAVVEELFRDG--IN
F6YNL8_BCL2-01          D------------EMSGQL-HL---TPV-TARGRFATVVEELFRDG--VN
H0YUX3_BCL2-01          S------------QMSGQL-HL---TPF-TARSRFVAVVEELFRDG--VN
H0W1T3_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFAT----LFRDG--VN
J9NXG3_BCL2-02          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
G1LID1_BCL2-02          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
I3MVK9_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
G1TW27_BCL2-01          A------------EMSSQL-HL---TPF-HARGRFATVVEELFRDG--VN
P10417_BCL2-02          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A096MPU7_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
P10417_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
Q7TSN8_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
Q6R755_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
Q9JJV8_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
Q923R6_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
F1LNV0_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
P49950_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
H2NWH5_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A3Q2HRY3_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K6G3I7_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A287APJ6_BCL2-03      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
H0WKI0_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K5UDI5_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K5EB04_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2R8MY14_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
Q568V1_MCL1-01          K------------GMIQRL-QL---DSQPASLDFIRCIASTMFKDGV-TN
Q1L8X3_MCL1-01          K------------GMIQRL-QL---DSQPASLDFIRCIASTMFKDGV-TN
Q9I9N3_MCL1-01          K------------GMIQRL-QL---DSQPASLDFIRCIASTMFKDGV-TN
A0A3B3ICL7_BCL2L1-      S------------DLSVQL-HI---TPD-TAYQNFKRVLDELFKDG--IN
A0A3B3E2W4_BCL2L1-      S------------DLSLQF-HI---TPD-TAYQNFKSVLDELFKDG--IN
A0A3B5B4X7_BCL2L1-      S------------DLSSQL-DI---TPD-TAYHSFKSVMDEVFKDG--VN
A0A3B4BFZ8_BCL2L1-      S------------NLSSQL-DI---TPD-TAYNSFKSVMDEVFKDG--VN
A0A3Q3FUB6_BCL2L1-      S------------DLSSQL-DI---TPN-TAYHSFKSVMDEVFKDG--VN
A0A3B5MGS2_BCL2L1-      K------------HLSLQL-DI---TPD-TAYHSFKTVLDELFKGG--VN
M4A558_BCL2L1-01        K------------HLSLQL-DI---TPD-TAYHSFKTVLDELFKGG--VN
A0A3P9QFB3_BCL2L1-      K------------HLSLQL-DI---TPD-TAYHSFKTVLDELFKGE--VN
A0A087YBW4_BCL2L1-      K------------HLSLQL-DI---TPD-TAYQSFKTVLDELFKGE--VN
A0A3B3VWI7_BCL2L1-      K------------HLSLQL-DI---TPD-TAYQSFKTVLDELFKGE--VN
A0A3B3XN57_BCL2L1-      K------------HLSLQL-DI---TPD-TAYQSFKTVLDELFKGE--VN
A0A3Q2C6K4_BCL2L1-      S------------DLSMQL-DI---TPD-TAYHSFKAVLDELFKDG--IN
A0A3Q2NRP4_BCL2L1-      S------------HLSLQL-DI---TPD-TAYHSFKAVLDELFKDG--VN
A0A0B4KJI5_BCL2L1-      S------------DLSTQL-DI---TPD-TAYHSFKSVMDEVFKDG--VN
A0A3Q1JZ46_BCL2L1-      S------------DLSSQL-DV---TPD-TAYQSFKSVMDELFKDG--VN
A0A3Q1JZ46_BCL2L1-      S------------DLSSQL-DV---TPD-TAYQSFKSVMDELFKDG--VN
A0A3Q3NFM4_BCL2L1-      S------------DLSSQL-DI---TPD-TAYHSFKSVMDEVFKDG--VN
A0A3Q3NFM4_BCL2L1-      S------------DLSSQL-DI---TPD-TAYHSFKSVMDEVFKDG--VN
A0A3B4V9K8_BCL2L1-      S------------DLSTQL-DI---TPD-TAYHSFKSVMDELFKDG--VN
A0A3B4XS24_BCL2L1-      S------------DLSTQL-DI---TPD-TAYHSFKSVMDELFKDG--VN
C1BLI0_BCL2L1-01        N------------DPSSQL-HI---TPA-TAYHSFESVMNEVFRDG--VN
C0HAD8_BCL2L1-01        S------------DLSSQL-HI---TPA-TAYHSFESVMDEVFRDG--VN
A0A3B3ZN55_BCL2L1-      S------------DLHRQL-HI---TPA-TAYQSFESVMDEVFRDG--VN
A0A3B5K6B9_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3B5K6B9_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
H3CH49_BCL2L1-01        S------------DLHNQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3B3TFR4_BCL2L1-      S------------DLSSQL-HI---TPA-TAYQSFESVMNEVFRDG--VN
A0A3Q2FR43_BCL2L1-      N------------DLHSTL-HI---TPA-TAYQSFENVMNEVFRDG--VN
A0A3P8XYL5_BCL2L1-      S------------DLSSQL-HL---TPA-TAYQSFASVMDEVFRDG--VN
Q90Z98_BCL2L1-02        N------------DLSSQL-HI---TPA-TAYQSFESVMDEVFRDG--VN
Q90Z98_BCL2L1-01        N------------DLSSQL-HI---TPA-TAYQSFESVMDEVFRDG--VN
A0A059PJI5_BCL2L1-      S------------DLSSQL-HI---TPV-TVYQSFESVMDEVFRDG--VN
A0A3B4DTL9_BCL2L1-      S------------DLSSQL-HI---TPA-TAYQSFESVMDEVFRDG--VN
B5XAY3_BCL2L1-01        S------------DLSSQL-HI---TPS-TAYQSFENVMDEVFRDG--VN
W5MG74_BCL2L1-01        S------------DLSSQL-HI---TPA-TAYQSFEHVMDEVFRDG--VN
A0A3Q3B3X5_BCL2L1-      S------------DLHSQL-HI---TPG-TVYQSFENVMDEVFRDG--VN
A0A3B3IB64_BCL2L1-      N------------NLHSQL-HI---TPA-TAYQSFENVMNELFRDN--IN
A0A3P9JYH1_BCL2L1-      N------------NLHSQL-HI---TPA-TAYQSFENVMNELFRDN--IN
A0A3B3DHA1_BCL2L1-      N------------NLHSQL-HI---TPA-TAYQSFENVMNELFRDN--IN
A0A3Q0RTF8_BCL2L1-      N------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
I3IZK7_BCL2L1-01        S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A2U9BY16_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFESVMNEVFRDG--VN
A0A0D6DR75_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFANVMDEVFRDG--VN
A0A3Q3WIW8_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A219P0Y3_BCL2L1-      S------------DLHHQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q3MX20_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFESVMDEVFRDG--VN
A0A3Q3G2E1_BCL2L1-      S------------DLHNQL-HI---TPA-TTHQSFENVMDEVFRDG--VN
A0A3Q3G2E1_BCL2L1-      S------------DLHNQL-HI---TPA-TTHQSFENVMDEVFRDG--VN
A0A3Q3G2E1_BCL2L1-      S------------DLHNQL-HI---TPA-TTHQSFENVMDEVFRDG--VN
A0A3Q1GZ93_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q1GZ93_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q1GZ93_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3B4V3T1_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFANVMDEVFRDG--FN
A0A3B4XU17_BCL2L1-      S------------DLHNQL-HI---TPA-TAYQSFANVMDEVFRDG--FN
A0A3B3QRZ2_BCL2L1-      S------------DLSSQL-HI---TPV-TAYQSFESVMNEVFRDG--IN
A0A3B3ZN55_BCL2L1-      S------------DLHRQL-HI---TPA-TAYQSFESVMDEVFRDG--VN
G3NJY1_BCL2L1-01        S------------DLHNQL-HI---TPA-TAYQSFEDVMDEVFRDG--VN
A0A3Q3DUT7_BCL2L1-      S------------DLDKQL-HI---TPA-TAYQSFENVVDEVFQDD--VN
A0A3Q3DUT7_BCL2L1-      S------------DLDKQL-HI---TPA-TAYQSFENVVDEVFQDD--VN
A0A3Q3DUT7_BCL2L1-      S------------DLDKQL-HI---TPA-TAYQSFENVVDEVFQDD--VN
A0A3B1JJ42_BCL2L1-      S------------DLSSQL-HI---TPA-TAYQSFESVMDEVFRDG--VN
A0A3P8UWG7_BCL2L1-      S------------DLHQQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q3IVF5_BCL2L1-      S------------DLHHQL-HI---TPA-TAYQSFESVMDEVFRDG--VN
A0A3Q1DHJ3_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q1DHJ3_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q1DHJ3_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3P8TL99_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3P8TL99_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q1GS47_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3B4Z3X2_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3B4Z3X2_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
C3VIT1_BCL2L1-01        S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3P8P0F1_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q2X557_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3P9D632_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3P9D632_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q4N4B5_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3B4FNX1_BCL2L1-      S------------DLHSQL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q2QPL9_BCL2L1-      N------------DLHSTL-HI---TPA-TAYQSFENVMNEVFRDG--VN
A0A3B5PQJ0_BCL2L1-      N------------DLHSTL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A087X9B7_BCL2L1-      N------------DLHSTL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3B3TUS7_BCL2L1-      N------------DLHSTL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3B3WI27_BCL2L1-      N------------DLHSTL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3P9N9Y4_BCL2L1-      N------------DLHSTL-HI---TPA-TAYQSFENVMDEVFRDG--VN
A0A3Q3BEB7_BCL2L1-      S------------HLSLQL-DI---SPD-TVYHSFKSVLDELFKDG--VN
A0A3P8VMA1_BCL2L1-      R------------NLFLKL-DL---TPD-TVYHSFKSVMDEVFRDG--VN
A0A345BSW9_BCL2L1-      N------------DLSSQL-HI---TPA-TAYQSFESVMDEVFRDG--VN
A0A286MU87_BCL2L1-      S------------DLSSQL-HI---TPA-TAYHSFESVMDEVFRDG--VN
A0A3P8XFS0_BCL2L1-      S------------DLSSQL-HI---TPA-TAYHSFESVMDEVFRDG--VN
A0A3P8XFS0_BCL2L1-      S------------DLSSQL-HI---TPA-TAYHSFESVMDEVFRDG--VN
A0A0F7L1T6_BCL2L1-      S------------DLSSQL-DI---TPD-TAYQSFKNVMDEVFKDG--DN
H2U5I3_BCL2L1-01        S------------DLSSQL-DI---TPD-TAYQSFKNVMDEVFKDG--VN
H2U5I3_BCL2L1-02        S------------DLSSQL-DI---TPD-TAYQSFKNVMDEVFKDG--VN
A0A3Q3J5K3_BCL2L1-      S------------DLSSQL-VI---TPD-TAYNSFKSVMDEVFKDG--VN
A0A3Q1EVP6_BCL2L1-      S------------DLSSQI-DI---TPE-TAYHSFKSVMDEVFKDG--VN
A0A3Q1BQA0_BCL2L1-      S------------DLSSQL-DI---TPE-TAYHSFKSVMDEVFKDG--VN
A0A3P8U812_BCL2L1-      S------------DLSSQL-DI---TPE-TAYHSFKSVMDEVFKDG--VN
E6ZFR0_BCL2L1-01        S------------DLSSQI-DI---TPD-TAYHSFKSVMDEVFKDG--VN
G3P7B4_BCL2L1-01        S------------DLSLQL-DV---TPD-TAYHSFKSVMDEVFKDG--VN
A0A3Q3X5M5_BCL2L1-      S------------DLSSQL-DI---TPD-TAYHSFKSVMDEVFKDG--VN
A0A2U9BIG9_BCL2L1-      S------------DLSLQL-DI---TPD-TAYQSFKSVMDEVFKDG--VN
A0A3B3C5I4_BCL2L10      S------------TLAQDF-RK---HCGPDLCSSLRKVMEELVGDEH-LN
A0A3Q2Y539_MCL1-01      N------------NMVNEL-SL---DQRGLDRSFVSQVAQTEFANGN-IN
H3AR18_MCL1-02          N------------GMQQKL-NI---HKE-DDLHIIPEIGNQIFKDGA-TN
A0A3B1K5R1_MCL1-01      K------------GMLNKL-GM---EDRGDDMYVIRAVAKELFSDGI-TN
A0A3B4C6H5_MCL1-01      K------------GMFTRL-GM---EDRGDDMHIIRTVAKELFSDGI-TN
A0A3B4C6H5_MCL1-02      K------------GMFTRL-GM---EDRGDDMHIIRTVAKELFSDGI-TN
A0A3B4C6H5_MCL1-03      K------------GMFTRL-GM---EDRGDDMHIIRTVAKELFSDGI-TN
A0A3Q1IAB0_BCL2L10      H------------SLAQTF-LK---QCGPDPCSSLRKVMEELVGDGH-MN
Q5XGJ4_BCL2L2-01        S------------EISTQI-HV---TPG-TAYARFAEVAGSLFQGG--VN
A0A3P8WUE9_BCL2-01      S------------EMSRQL-YL---TSS-TAQRRFTEVIDELFRDG--VN
A0A3Q3G1D7_BCL2-01      T------------EMSRQL-YL---TST-TAQRRFAEVIDELFRDG--VN
A0A3B4A3G8_BCL2-01      T------------EMSRQL-YL---TSS-TAQRRFAEVIDELFRDG--VN
D2ITA2_BCL2L1-02        S------------DLSSQL-PI---TPA-TAYGSFESVMDEVFRDS--IN
A0A452FIG6_BCL2L1-      S------------DLTSQL-HT---TPG-TAYQSFEQVMYELFWDG--VN
A0A452FIG6_BCL2L1-      S------------DLTSQL-HT---TPG-TAYQSFEQVMYELFWDG--VN
Q8UWD6_MCL1-01          K------------GMIARL-NL---EQKGEDVSFIKQVATELFSDGT-TN
F8W4Q8_MCL1-01          K------------GMIARL-NL---EQKGEDVSFIKQVATELFSDGT-TN
Q568W5_MCL1-01          K------------GMIARL-NL---EQKGEDVSFIKQVATELFSDGT-TN
M3Y8D1_BCL2L10-01       V------------ELVAQL-ER---EILAHPQA---------------LS
H3ANS8_BCL2L1-01        S------------DLSSQL-HI---TPG-TAYQSFEQVVNELFRDG--VN
F7G6M3_BCL2L2-01        S------------DLASQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
G1TV33_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQSFTQVCDELFQRG--PN
A0A2K5CWZ4_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2R8M4C0_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
G3TMU7_BCL2L2-01        S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K5CWZ4_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A2K6TM77_BCL2L2-      S------------DLAAQL-HV---TPG-SAQQRFTQVSDELFQGG--PN
A0A3P8W7K5_BCL2L10      Q------------TLSQSF-LR---QCGSEPCVCLRKVMEELVGDGH-LN
A0A3B3ICL7_BCL2L1-      S------------DLSVQL-HI---TPD-TAYQNFKRVLDELFKDG--IN
A0A452U2H8_BCL2A1-      K------------PCLDSF-DV---VSVDSARTIFNQVMEKEFEDGI-IN
A0A452U2H8_BCL2A1-      K------------PCLDSF-DV---VSVDSARTIFNQVMEKEFEDGI-IN
F7BXJ7_BCL2-01          R------------QISGLL-HL---TPS-TVRVRFATVVEELFHDG--VN
A0A3B3TCS4_BCL2-01      S------------EMHEEL-HI---TPS-TAQRRFTAVIEELFSDG--VN
H0Z8G3_BCL2L1-01        S------------DLTSQL-HI---TPS-TAYQSFEQVVNELFRDG--VN
U3JSL7_BCL2L1-01        S------------DLTSQL-HI---TPS-TAYQSFEQVVNELFRDG--VN
Q4U2V6_BCL2L1-01        S------------DLTSQL-HI---TPS-TAYQSFEQVVNELFRDG--VN
A0A3P8YNB4_BCL2-01      L------------EMSHQL-YL---TSS-VAERRFREVIDELFRDG--VN
A0A3P9AAB2_BCL2-01      A------------EMSGQL-HI---TPS-TAHGRFTAVIDELFSDG--VN
A0A0U3DHY6_BCL2-01      A------------EMSGQL-HF---TPS-TAQXRFTAVIDELFSDG--VN
X4ZGI8_BCL2-01          E------------EMSHQM-TF---SPS-AAQRSFLAVAEELFRDG--VN
U3KEW4_BCL2-01          A------------QMSGQL-HL---TPF-TARSRFVAVVEELFRDG--VN
Q00709_BCL2-01          A------------QMSGQL-HL---TPF-TAHGRFVAVVEELFRDG--VN
K7F5Y4_BCL2-03          A------------QMSGQL-HL---TPF-TARGRFVAVVEELFRDG--IN
G3WZW9_BCL2-01          D------------EMSGQL-HL---TPV-TARGRFATVVEELFRDG--VN
A0A452R145_BCL2-02      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
M3YYK3_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
P10415_BCL2-04          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K6R2I6_BCL2-02      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
J9NXG3_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A1D5QRF2_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2R9APW6_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
G3ULB7_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A9QXG9_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K5NZS5_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A0D9S017_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K6CIX3_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K5XRD4_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K6KHG1_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K6R2I6_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K5HK49_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
G3QES9_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2I3GZF9_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2K6UEL3_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
P10415_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
P10415_BCL2-02          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
H2QEM8_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A2U4BHU7_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
Q75SV7_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
M3X1R9_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A076FU27_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
F6R2C4_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
O02718_BCL2-01          A------------EMSSQL-HL---TPF-TARERFATVVEELFRDG--VN
A0A076FZV9_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A452EV13_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
G1LID1_BCL2-01          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A452R145_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
G3WZW9_BCL2-02          D------------EMSGQL-HL---TPV-TARGRFATVVEELFRDG--VN
G3ULB7_BCL2-02          A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
A0A452T603_BCL2-01      A------------EMSSQL-HL---TPF-TARGRFATVVEELFRDG--VN
G3PJT0_MCL1-01          N------------GMVNKL-SL---DDRGDDASFVREVATSLFADGT-TN
A0A3Q3VP02_MCL1-01      N------------GMTKRL-SL---ADTQDNVSFVSTVSRDLFSDGA-TN
A0A3B5K5B3_MCL1-01      N------------GMTKQL-TL---DDRGDDVSFVSSVAKSIFADGV-TN
H2MLZ3_MCL1-01          N------------GMIVRL-SL---DDQGDDMSFVSSVAKSLFADGT-TN
H2MLZ3_MCL1-02          N------------GMIVRL-SL---DDQGDDMSFVSSVAKSLFADGT-TN
A0A3B3CEX1_MCL1-02      N------------GMINRL-SL---EDNLDDMSFISRVAENMFADRT-TN
A0A3B3CEX1_MCL1-01      N------------GMINRL-SL---EDNLDDMSFISRVAENMFADRT-TN
A0A3Q3B4V7_MCL1-01      N------------GIIKKL-SL---DDKSEDMTFVTKTARSLFADGI-TN
A0A3Q3B4V7_MCL1-02      N------------GIIKKL-SL---DDKSEDMTFVTKTARSLFADGI-TN
A0A3Q2EDX8_MCL1-01      N------------GMMNKL-CL---DEVPDNMGFVSSVATSLFSDGT-TN
A0A3Q2T2A9_MCL1-02      T------------GMIRKL-NL---DQKSDDMGFVTSVAVSLFSDGT-TN
A0A3Q2T2A9_MCL1-01      T------------GMIRKL-NL---DQKSDDMGFVTSVAVSLFSDGT-TN
A0A3B5PQ55_MCL1-02      N------------GMVNRL-AL---DNEPDDMEFVTEIAESLFSDGI-TN
A0A3B5PQ55_MCL1-01      N------------GMVNRL-AL---DNEPDDMEFVTEIAESLFSDGI-TN
A0A3P9Q4R7_MCL1-02      N------------GMLSKL-AL---DNQPDNMGFVTEVAESLFSDGT-TN
A0A3P9Q4R7_MCL1-01      N------------GMLSKL-AL---DNQPDNMGFVTEVAESLFSDGT-TN
A0A087X830_MCL1-01      N------------GMLNRL-AL---DNQPDNMGFVTEVAENLFSDGT-TN
A0A3B3YCD0_MCL1-01      N------------GMLNRL-AL---DNQPDNMGFVTEVAENLFSDGT-TN
A0A3P8VKS9_MCL1-02      N------------GMINKL-SL---ENRQGDLTFISSVAKSLFGDGT-TN
A0A3P8VKS9_MCL1-01      N------------GMINKL-SL---ENRQGDLTFISSVAKSLFGDGT-TN
A0A3P8VKS9_MCL1-05      N------------GMINKL-SL---ENRQGDLTFISSVAKSLFGDGT-TN
A0A3P8VKS9_MCL1-04      N------------GMINKL-SL---ENRQGDLTFISSVAKSLFGDGT-TN
A0A3P8VKS9_MCL1-03      N------------GMINKL-SL---ENRQGDLTFISSVAKSLFGDGT-TN
I3JHR5_MCL1-01          N------------GMINKL-SL---DERHEDMSFVGAVAKSLFADHT-TN
A0A3Q4HLQ8_MCL1-01      N------------GMINKL-SL---DERDEDMSFVGAVAKSLFGDHT-TN
A0A3P8NP63_MCL1-02      N------------GMINKL-SL---DERDEDMSFVGAVAKSLFGDHT-TN
A0A3P8NP63_MCL1-03      N------------GMINKL-SL---DERDEDMSFVGAVAKSLFGDHT-TN
A0A3Q2VNL8_MCL1-01      N------------GMINKL-SL---DERDEDMSFVGAVAKSLFGDHT-TN
A0A3P8NP63_MCL1-01      N------------GMINKL-SL---DERDEDMSFVGAVAKSLFGDHT-TN
A0A3P9BVM3_MCL1-01      N------------GMINKL-SL---DERDEDMSFVGAVAKSLFGDHT-TN
A0A3B4G4Z6_MCL1-01      N------------GMINKL-SL---DERDEDMSFVGAVAKSLFGDHT-TN
A0A2U9CJ81_MCL1-01      N------------GMMNRL-SL---DNRRDDVTFVGAVARSLFGDGN-TN
A0A3Q3IZW0_MCL1-01      K------------GMINKL-SL---DERGDDMSFVGSVAQSIFADGT-TN
A0A3Q1GX28_MCL1-02      N------------GMINKL-SL---DDKVDDVSFITAVAQSLFSDGT-TN
A0A3Q1GX28_MCL1-01      N------------GMINKL-SL---DDKVDDVSFITAVAQSLFSDGT-TN
A0A3B4XKA5_MCL1-01      N------------GMINKL-SL---DNRGDDVRFVGAVAKSLFADGT-TN
A0A3Q3GP42_MCL1-01      N------------GMINKL-SL---EDRGDDASFVSAVAKSLFADGT-TN
A0A3Q3M6G2_MCL1-02      N------------GMINKL-SL---DDRGDDVRFVSTVAKSLFADGT-TN
A0A3Q3M6G2_MCL1-01      N------------GMINKL-SL---DDRGDDVRFVSTVAKSLFADGT-TN
W5MMB7_MCL1-01          H------------GMIAKL-EL---ENKGEDVSFVTGVAKSLFSDGK-TN
A0A3B3R4U0_MCL1-01      N------------GMIKKL-EL---DKRGDDTSFVTKVAEEIFSDKV-TN
A0A3B3SG34_MCL1-01      N------------GMIGKL-SL---NQQSDDMTVIKTVAERIFSDGT-TN
Q4SW32_MCL1-01          R------------GMINKL-FM---EDRVGDVSFVGAVAKSTFEDGN-TN
D2ITA0_MCL1-03          K------------GMIQKL-EL---DGRGEDMSFVTSVAKSLFADST-TN
D2ITA0_MCL1-04          K------------GMIQKL-EL---DGRGEDMSFVTSVAKSLFADST-TN
Q0KFR9_MCL1-01          N------------GMVAKL-DL---DDRCDDMGVINSVAKTMFSDGI-TN
A0A3P8Y1W8_MCL1-01      K------------GMISKL-CL---DDQGDDMGFITSVAKSLFSDGT-TN
A0A3P8Y1W8_MCL1-02      K------------GMISKL-CL---DDQGDDMGFITSVAKSLFSDGT-TN
A0A3Q2XZL8_MCL1-01      N------------GIINKL-SL---DDRGDNVSFISEVAKSLFSDGT-TN
A0A3B4AFB7_MCL1-02      N------------GMINKL-AL---DDRGDDVSFIGTVAKSIFEDGT-TN
A0A3B3VM25_MCL1-01      N------------GMLNRL-AL---DNQPDNMGFVTEVAQNLFSDGT-TN
A0A3Q0RA11_MCL1-03      N------------GMVNKL-SL---DERGEDVTFVSAVAKSLFADKT-TN
A0A3Q0RA11_MCL1-01      N------------GMVNKL-SL---DERGEDVTFVSAVAKSLFADKT-TN
A0A3B4T8L9_MCL1-02      N------------GMINKL-SL---DNTGDDVRFVGAVAKSLFADGT-TN
A0A3B4T8L9_MCL1-01      N------------GMINKL-SL---DNTGDDVRFVGAVAKSLFADGT-TN
A0A3Q1EQB9_MCL1-02      N------------GMINKL-SL---DDIGDDVSFVSAVAKSLFADRT-TN
A0A3B4ZKP6_MCL1-01      N------------GMINKL-SL---DDRGDDVSFVSAVAKSLFADRT-TN
A0A3Q1BKL8_MCL1-02      N------------GMINKL-SL---DDRGDDVSFVSAVAKSLFADRT-TN
A0A3Q1EQB9_MCL1-01      N------------GMINKL-SL---DDIGDDVSFVSAVAKSLFADRT-TN
A0A3Q1BKL8_MCL1-01      N------------GMINKL-SL---DDRGDDVSFVSAVAKSLFADRT-TN
A0A3P8RQX7_MCL1-02      N------------GMINKL-SL---DDRGDDVSFVSAVAKSLFADRT-TN
A0A3P8RQX7_MCL1-01      N------------GMINKL-SL---DDRGDDVSFVSAVAKSLFADRT-TN
U3JTB2_BCL2A1-01        R------------PLLDRI-DI---TSVAVAKRIFNGVMDEKFADGN-TN
H0ZCL9_BCL2A1-01        R------------PLLDRI-DI---TSVAAAKRIFNGVMDEKFADGN-TN
Q9W6F2_BCL2A1-01        R------------PFLDRI-DI---TSVDVAKRIFNGVMEEKFADGN-TN
G1N8C5_BCL2A1-01        R------------PFLDRI-DI---TSVDVAKRIFNGVMEEKFADGN-TN
A0A452J3N6_BCL2A1-      K------------PCLDTF-DI---TSVDAARRIFTQVMDKEFADGN-TN
K7G130_BCL2A1-01        K------------PCLDTL-DI---TSVDAARRIFIQVMDKEFDDGN-TN
F6SFL4_BCL2A1-01        E------------TCLSTL-DI---VSVESARRIFNSVMKKEFEDGV-IN
G3WSP8_BCL2A1-01        E------------TFLSTL-DI---TSVDCARRIFNSVMEKEFEDGI-IN
F6S8G3_BCL2A1-01        K------------PCFDSL-DV---GSVGAARRIFGQIVEKEFEDGI-VN
G1T1L8_BCL2A1-01        Q------------PYLHNV-PV---ASVETARTIFNQVMEKEFEDGV-IN
O55178_BCL2A1-01        K------------SYLDDF-HV---ESIDTTRIIFNQVMEKEFEDGI-IN
Q0P538_BCL2A1-01        K------------SYLDDF-HV---ESIDTTRIIFNQVMEKEFENGI-IN
A0A337STN9_BCL2A1-      K------------PCLDKF-HV---VSVDTARTIFHQVMEKEFEDGI-IN
A0A337STN9_BCL2A1-      K------------PCLDKF-HV---VSVDTARTIFHQVMEKEFEDGI-IN
E2RS00_BCL2A1-01        K------------PCLDSF-DV---VSVDTARTIFNQVMEKEFEDGV-IN
M3YVH4_BCL2A1-01        R------------PCLDSF-DV---GSIDTARTIFNQVMEKEFEDGI-IN
A0A452SIR9_BCL2A1-      K------------PCLDSF-DV---VSVDSARTIFNQVMEKEFEDGI-IN
G3V977_BCL2A1-01        K------------PYLDDF-HV---ESIDTARIIFNQVMEKEFEDGI-IN
Q925A9_BCL2A1-01        K------------PYLDDF-HV---ESIDTARIIFNQVMEKEFEDGI-IN
Q07440_BCL2A1-01        K------------SYLDDF-HV---ESIDTARIIFNQVMEKEFEDGI-IN
O55179_BCL2A1-01        K------------SYLDDF-HV---ESIDTARIIFNQVMEKEFEDGI-IN
O55177_BCL2A1-02        K------------SYLDDF-HV---ESIDTARIIFNQVMEKEFEDGI-IN
Q497M6_BCL2A1-01        K------------SYLDDF-HV---ESIDTARIIFNQVMEKEFEDGI-IN
Q8K164_BCL2A1-01        K------------SYLDDF-HV---ESIDTARIIFNQVMEKEFEDGI-IN
Q4FK02_BCL2A1-01        K------------SYLDDF-HV---ESIDTARIIFNQVMEKEFEDGI-IN
I3MCZ7_BCL2A1-01        K------------PFLDNF-DV---VSADTARTIFNQVMEKEFEDGI-MN
G3T8E6_BCL2A1-01        K------------PCLDNF-VV---ISIDTAQTIFKQVMEKEFEDGI-IN
H0WZ23_BCL2A1-01        K------------PCLDNF-NV---VSIDTARTIFNQVMEKEFEDGI-IN
A0A2K6TLM0_BCL2A1-      K------------PCLDNV-HI---VSMDNARTIFSQVMEKEFEDGI-IN
A0A2K5D2I1_BCL2A1-      K------------PCLDNV-NI---VSIDNARMIFSQVMEKEFEDGI-IN
U3DBA0_BCL2A1-02        K------------SCLDNV-DI---ASIDNARTIFSQVMEKEFEDGI-IN
A0A2K6TLM0_BCL2A1-      K------------PCLDNV-HI---VSMDNARTIFSQVMEKEFEDGI-IN
B4E1X9_BCL2A1-01        K------------SCLDNV-NV---VSVDTARTLFNQVMEKEFEDGI-IN
Q16548_BCL2A1-02        K------------SCLDNV-NV---VSVDTARTLFNQVMEKEFEDGI-IN
A0A2I2YML2_BCL2A1-      K------------SCLDNV-NV---VSIDTARTLFNQVMEKEFEDGI-IN
A0A2R8ZJX9_BCL2A1-      K------------SCLDNV-NV---VSVDTARTLFNQVMEKEFEDGI-IN
A0A2I3T6T8_BCL2A1-      K------------SCLDNV-NV---VSVDTARTLFNQVMEKEFEDGI-IN
A0A2I3HNF3_BCL2A1-      K------------PCLDNV-NV---VSIDTARTLFNQVMEKEFEDGI-IN
A0A2K6PHG5_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K6LV22_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
F7E8V5_BCL2A1-02        K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K5KHH9_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K6AD55_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K5TMD8_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K5KAB6_BCL2A1-      K------------PCLDNV-NV---ASIDTARTIFNQVMEKEFEDGI-IN
A0A2K6DS80_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A096NMX5_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K6EKG1_BCL2A1-      K------------ACLDNV-NV---ASIDAARTIFNQVMEKEFEDGI-VN
Q3C2I0_BCL2A1-01        K------------QCLDKF-DV---VSVDTARTIFNQVMEKEFEDGI-VN
A0A452EK63_BCL2A1-      K------------QCLDKF-DV---VSVDTARTIFNQVMEKEFEDGI-VN
W5Q0N6_BCL2A1-01        K------------QCLDKF-DV---VSVDTARTIFNQVMEKEFEDGI-VN
F7CP56_BCL2A1-01        K------------PCLDNF-HV---VSIDAARTIFNQVMEKQFEDGI-IN
C7F841_BCL2A1-02        K------------PCLDNF-DV---VSIDTARIIFNQVMEKEFEDGI-IN
C7F841_BCL2A1-01        K------------PCLDNF-DV---VSIDTARIIFNQVMEKEFEDGI-IN
A0A2I3HNF3_BCL2A1-      K------------PCLDNV-NV---VSIDTARTLFNQVMEKEFEDGI-IN
A0A2I2YML2_BCL2A1-      K------------SCLDNV-NV---VSIDTARTLFNQVMEKEFEDGI-IN
A0A2R8ZJX9_BCL2A1-      K------------SCLDNV-NV---VSVDTARTLFNQVMEKEFEDGI-IN
A0A2I3T6T8_BCL2A1-      K------------SCLDNV-NV---VSVDTARTLFNQVMEKEFEDGI-IN
H2NNZ9_BCL2A1-01        K------------PCLDNV-NV---VSVDTARTLFNQVMEKEFEDGI-IN
Q16548_BCL2A1-01        K------------SCLDNV-NV---VSVDTARTLFNQVMEKEFEDGI-IN
A0A2I2YML2_BCL2A1-      K------------SCLDNV-NV---VSIDTARTLFNQVMEKEFEDGI-IN
A0A2K6LV22_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K6PHG5_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2R8ZJX9_BCL2A1-      K------------SCLDNV-NV---VSVDTARTLFNQVMEKEFEDGI-IN
A0A2I3T6T8_BCL2A1-      K------------SCLDNV-NV---VSVDTARTLFNQVMEKEFEDGI-IN
A0A2I3HNF3_BCL2A1-      K------------PCLDNV-NV---VSIDTARTLFNQVMEKEFEDGI-IN
A0A2K5KHH9_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K5KHH9_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K5KAB6_BCL2A1-      K------------PCLDNV-NV---ASIDTARTIFNQVMEKEFEDGI-IN
A0A2K5TMD8_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
F7E8V5_BCL2A1-01        K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K6DS80_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K6AD55_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A096NMX5_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A0D9RRC3_BCL2A1-      K------------PCLDNV-NV---ASIDTARTLFNQVMEKEFEDGI-IN
A0A2K5D2I1_BCL2A1-      K------------PCLDNV-NI---VSIDNARMIFSQVMEKEFEDGI-IN
U3DBA0_BCL2A1-01        K------------SCLDNV-DI---ASIDNARTIFSQVMEKEFEDGI-IN
A0A2K6TLM0_BCL2A1-      K------------PCLDNV-HI---VSMDNARTIFSQVMEKEFEDGI-IN
R4JQR8_BCL2L1-01        FDDMVNQLHITEATAYPTF------------QRVVQELFI---DG-N-IN
A0A346RRN1_BCL2L1-      FDDMVDQLHITEATAYPTF------------QRVVQELFI---DG-N-IN
Q99M66_BCL2L10-01       F------------NSFRDY-QG---NRLELVTQMADELLS---NDQE-FN
F6ZPD4_BCL2L10-01       L------------SRYRGF-RG---DHVGLAARMAQAIFG---DRHV-PS
Q9Z0F3_BCL2L10-01       F------------SSFCES-RG---NRLELVKQMADKLLS---KDQD-FS
E1B9B3_BCL2L10-01       L------------PLYRRC-RR---HRVELVARMAQRLLD---EDPG-PS
F1RZB9_BCL2L10-01       L------------SVYRGF-RW---NRVELVAWMAQKLLA---SPRG-PN
G1T264_BCL2L10-01       F------------SVYRGY-PG---NRIELAARVAEAVLS---DGHD-LS
F1MV39_BCL2L10-01       L------------PLYRRC-RR---HRVELVARMAQRLLD---EDPG-PS
W5QIG4_BCL2L10-01       L------------PLYRRY-RR---HRVELVARMAQRLLD---EDPG-PS
A0A2K6F2Q2_BCL2L10      F------------SAYVGY-PG---NRVYLLERMAEAVLC---DS---LS
H0WZ06_BCL2L10-01       F------------SAYIGY-PG---NRVQVVERMVKAMLS---DNQR-LN
A0A2K6TIT7_BCL2L10      F------------SAYRGY-PR---NRVELVARMAEALLS---DSPG-PT
A0A2K5F974_BCL2L10      F------------SAYLGY-PG---NRVELVARMAEALLS---DSPG-PT
F7CT87_BCL2L10-01       F------------SAYLGY-PG---NRVELVARMAEALLS---DSPG-PT
A0A0D9RG38_BCL2L10      F------------SAYLGY-PG---NRVELVALMADAVLS---DSPG-PT
A0A096NM44_BCL2L10      F------------SAYRGY-PG---NRVELVALMAEAVLS---DSPG-PT
A0A2K6R5T5_BCL2L10      F------------SAYLGY-PG---NRVELVALMAEAVLS---DSPG-PT
Q9HD36_BCL2L10-02       F------------SAYLGY-PG---NRFELVALMADSVLS---DSPG-PT
G1R3W6_BCL2L10-01       F------------SAYLGY-PG---NRVELVVLMADSVLS---DSPG-PT
A0A2K5K3B0_BCL2L10      F------------SAYLGY-PG---NRVELVALMAEAVLS---DSPG-PT
A0A2K6M5H5_BCL2L10      F------------SAYLGY-PG---NRVELVALMAEAVLS---DSPG-PT
A0A2K5TKG9_BCL2L10      F------------SAYRGY-PG---NRVELVALMAEAVLS---DSPG-PT
F7H6U5_BCL2L10-01       F------------SAYRGY-PG---NRVELVALMAEAVLS---DSPG-PT
A0A2K6B2D9_BCL2L10      F------------SAYRGY-PG---NRVELVALMAEAVLS---DSPG-PT
A0A2K5MMZ4_BCL2L10      F------------SAYRGY-RG---NRVELVALMAEAVLS---DSPG-PT
H2NN92_BCL2L10-01       F------------SAYLGY-PG---NRVELVALMADSVLS---DSPS-PT
G3QLU6_BCL2L10-01       F------------SAYLGY-PG---NRFELVALMADSVLS---DSPG-PT
A0A2R9BCD9_BCL2L10      F------------SAYLGY-PG---NRFELVALMADSVLS---DSPG-PT
H2Q9G4_BCL2L10-01       F------------SAYLGY-PG---NRFELVALMADSVLS---DSPG-PT
Q9HD36_BCL2L10-01       F------------SAYLGY-PG---NRFELVALMADSVLS---DSPG-PT
A0A337RYG8_BCL2L10      L------------SAYRGY-RG---NRVELVARLEQDLLS---NPQT-LS
G1LKR4_BCL2L10-01       L------------SDYRGYAGG---NRVELVAQVEREILA---HPQP-LS
A0A452QJG0_BCL2L10      L------------SDYRGY-GG---NRVELVAQVEREILA---HPQP-LS
P70345_BCL2L2-03        -------------PLVGQV-----------------------------QD
A0A2I3T6T8_BCL2A1-      -----------------VA-----------------------------RS
                                                                          

G1MZW1_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A3Q0RA11_MCL1-02      WGRIASLMAFGAVVC----------QR---------------LKEKGRD-
I3KXG5_MCL1-01          WGRIVSFVAFGAVVS----------QH---------------LKEKGRD-
U3KKY6_MCL1-01          WGRVVTLIAFGAFVA----------KH---------------LKSIKQE-
G1MPY7_MCL1-01          WGRVVTLISFGAFVA----------KH---------------LKSINQE-
K7FPN7_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
F6VJQ0_BCL2L10-01       WGRVAVLVVFAGALL----------EM---------------EELLKEE-
A0A3Q1GS47_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A2K5DMS4_MCL1-01      WGRIVTLSSFGAFVA----------KH---------------LKTINQE-
A0A3P8V8T6_MCL1-01      WGRIVSLVAFGAVLC----------QH---------------LKEKGWE-
B6V6J0_MCL1-01          WGRIVTVISFGAFVA----------KH---------------LKSLNLE-
F7ETY1_MCL1-01          WGRIVTVISFGAFVA----------KH---------------LKSIDLE-
A0A287APJ6_BCL2-01      PEQVAKQIVKDAIQG----------NF---------------NSSIGSDG
H3AR18_MCL1-01          WGRIVSLIAFGAVVA----------KK---------------LKKMNLE-
F7G4L5_BCL2L2-04        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6GWN0_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2R8M4C0_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K5CWZ4_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2I2YPX6_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6TM77_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
W5QDH5_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
D3Z5F7_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6MEE6_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6RW46_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A384DPS8_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K5MZX9_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K5HEK7_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K5V0Q3_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
F7G4L5_BCL2L2-05        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6EA73_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6AI30_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
G1RYB4_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2R9A7B2_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
H2Q805_BCL2L2-02        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2I3MUE4_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A287AW74_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A384DPS8_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
J7H260_MCL1-01          WGRIVTVISFGAFVA----------KH---------------LKSIHME-
H0XHA5_MCL1-01          WGRIMTLI-FGGFVA----------KH---------------LKTINQE-
R4GAJ0_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
R4GAJ0_MCL1-02          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
G1QAV8_MCL1-01          -GRIVTHFFWC--LC----------SH---------------LKSINQE-
A0A2K6F6N9_MCL1-01      WGRIVTLISFCAFVS----------KH---------------LKTINQE-
M3XAP4_MCL1-03          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A2K6GI15_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKSINQE-
C8YZ26_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5CFH3_MCL1-02      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
F7GTF7_MCL1-03          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K6V5Y3_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5LXU8_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5I9Q7_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2I2YQH7_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
Q07820_MCL1-04          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5W0W9_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
F7HUE9_MCL1-02          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K6ECR0_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5XSC7_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2R9BYH6_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
K7DE58_MCL1-03          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2I3M3D6_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K6KRW9_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K6PPL1_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
K7DE58_MCL1-04          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2I3GB35_MCL1-03      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
G2HFR3_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A1L1RNM6_MCL1-01      WGRVVTLISFGAFVA----------KH---------------LKSINQE-
A0A1L1RNM6_MCL1-02      WGRVVTLISFGAFVA----------KH---------------LKSINQE-
F6ZMX1_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A286Y1M5_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKSINQE-
P97287_MCL1-02          WGRIVTLISFGAFVA----------KH---------------LKSVNQE-
P97287_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSVNQE-
G3T756_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSVNQE-
G1L3M8_MCL1-02          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A2U3V2H3_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKSINQE-
K9IWB2_MCL1-03          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
K9IWB2_MCL1-02          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
K9IWB2_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
B4DU51_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A287DCH9_MCL1-02      WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A287DCH9_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A452GAH0_MCL1-02      WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A2K5I9Q7_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
G1PZ39_MCL1-01          WAPVGGNRDEPGLEG----------LS---------------ARFRNQHI
Q95KR3_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A2K5EPY9_MCL1-02      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5EPY9_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
J9PBC4_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A2K5C7L5_MCL1-01      W----------------------------------------------HQ-
Q9Z1P3_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A5PJR2_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A452GAH0_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKSINQE-
G1L3M8_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
F7AVA6_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
G1T2Q0_MCL1-02          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
G1T2Q0_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
M3XAP4_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
Q7YRZ9_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
J9PBC4_MCL1-02          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
Q8HYS5_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
M3XZZ5_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A452RHX5_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKSINQE-
H0XFB7_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
A0A2K6GI15_MCL1-02      WGRIVTLISFGAFVA----------KH---------------LKSINQE-
F7GTF7_MCL1-02          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5CFH3_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K6V5Y3_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K6KRW9_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K6PPL1_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5XSC7_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A0D9RZP5_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5W0W9_MCL1-02      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
I7G687_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
F7HUE9_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K6ECR0_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2I3M3D6_MCL1-02      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5LXU8_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2I3GB35_MCL1-02      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
H2N5Y9_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
Q07820_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2R9BYH6_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
K7DE58_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2I2YQH7_MCL1-01      WGRIVTLISFGAFVA----------KH---------------LKTINQE-
A0A2K5I9Q7_MCL1-02      W----------------------------------------------HQ-
M3XAP4_MCL1-02          W----------------------------------------------HQ-
A0A2K6GI15_MCL1-01      R----------------------------------------------HQ-
F7GTF7_MCL1-01          W----------------------------------------------HQ-
A0A2K5CFH3_MCL1-03      W----------------------------------------------HQ-
A0A2K6V5Y3_MCL1-02      W----------------------------------------------HQ-
A0A2K6KRW9_MCL1-02      W----------------------------------------------HQ-
A0A2K6PPL1_MCL1-02      W----------------------------------------------HQ-
A0A2K5LXU8_MCL1-02      W----------------------------------------------HQ-
A0A2K5W0W9_MCL1-01      W----------------------------------------------HQ-
A0A2K6ECR0_MCL1-02      W----------------------------------------------HQ-
A0A2I3M3D6_MCL1-01      W----------------------------------------------HQ-
A0A2K5XSC7_MCL1-02      W----------------------------------------------HQ-
A0A2I3GB35_MCL1-01      W----------------------------------------------HQ-
Q07820_MCL1-03          W----------------------------------------------HQ-
A0A2R9BYH6_MCL1-02      W----------------------------------------------HQ-
K7DE58_MCL1-02          W----------------------------------------------HQ-
A0A2I2YQH7_MCL1-02      W----------------------------------------------HQ-
G3WBC5_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
W5QI41_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKSINQE-
F1MQX4_MCL1-01          WGRIVTLISFGAFVA----------KH---------------FKSINQE-
B4DLY8_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
B4DG83_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
B4E3L8_MCL1-01          WGRIVTLISFGAFVA----------KH---------------LKTINQE-
F8W4Q8_MCL1-02          WGRIASLLTFGAMLC---------------------------KYQNDRG-
G1QEX2_BCL2L10-01       WLSVVALVSFAGALL----------ERPPPGHS---------QARREWD-
H3AAS7_BCL2L2-02        WGRVVALFVFSAALC----------VE---------------SVDKEMA-
H3AAS7_BCL2L2-01        WGRVVALFVFSAALC----------VE---------------SVDKEMA-
F6TEC3_BCL2L2-01        WGRIVAFFVFGAALC----------AE---------------SVNKEMS-
G1Q051_BCL2L2-01        WGYLVAFFVFGAALC----------VE---------------SVNKEME-
G3WPT2_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
P70345_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
O88996_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A3Q9B4M8_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
H0XR82_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
Q92843_BCL2L2-02        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
Q05KI8_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
Q1RMX3_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
Q45T69_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A452ECF0_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A286XQQ9_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEMQ-
A0A2K5MZX9_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A0D9RU30_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K5HEK7_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
F6PH48_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2I2UAE3_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2I2YPX6_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
I3ND50_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K5V0Q3_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
F7G4L5_BCL2L2-02        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
F7G4L5_BCL2L2-03        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6EA73_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6AI30_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
G1RYB4_BCL2L2-03        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2R9A7B2_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
H2Q805_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2I3MUE4_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6GWN0_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6MEE6_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6RW46_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6RW46_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6TM77_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A287AW74_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2U4CFE3_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A452SHI1_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A384DPS8_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
F6U940_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
G3WPT2_BCL2L2-02        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
W5QDH5_BCL2L2-02        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
Q7TS60_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
G1LMC3_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
M3Y5X5_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
G1P3J2_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
I3ND50_BCL2L2-02        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
P70345_BCL2L2-04        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
Q6GLI5_BCL2L1-01        WGRIVAFFSFGRALC----------VE---------------SANKEMT-
Q2TAP5_BCL2L1-01        WGRIVAFFSFGRALC----------VE---------------SANKEMT-
Q91828_BCL2L1-01        WGRIVAFFSFGRALC----------VE---------------SANKEMT-
I7GKS6_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K5EBP4_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K6UWY8_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A3Q1LRT3_BCL2L1-      WGHVVAFFSFSGTLC----------MK---------------SIDKEIH-
A0A2K5M8B1_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K5H963_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
G3RY91_BCL2L1-02        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K5VPG2_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
F6UKR4_BCL2L1-02        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K5YR37_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K6LPM4_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K6QFA2_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K6G3C5_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
H9GHK7_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q07816_BCL2L1-04        PGEWRL-----GALCGSVWEQRCCRAE---------------EGPGDLQ-
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      WCRNVAFFSFGGALC----------MK---------------SIVKEMQ-
W5PSA5_BCL2L1-01        WGRNVAFFSFGGALC----------MK---------------SIVKEMQ-
Q07816_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMR-
Q07816_BCL2L1-03        WGRIVAFFSFGGALC----------VE---------------SVDKEMR-
Q07816_BCL2L1-02        WGRIVAFFSFGGALC----------VE---------------SVDKEMR-
G1N5N5_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMR-
A0A452ILL8_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A452ILL8_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
K7F655_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A287CZ07_BCL2L1-      WGHIVAFLSFGGALC----------ME---------------SVDKEMQ-
F6WA14_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEME-
G3WKX6_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEME-
F6WQI0_BCL2L1-02        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
G3SPN0_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
H0X6V2_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q2PFS6_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
P53563_BCL2L1-02        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
P53563_BCL2L1-03        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
O35843_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
G1RER8_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q64373_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q64373_BCL2L1-09        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
P53563_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2U3V0P1_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
O77737_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q9MYW4_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEME-
F6WQI0_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
B2Z3Z4_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q05KJ0_BCL2L1-02        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q05KJ0_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
E2IV76_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K6G3C5_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
M3Z2H9_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A0D9RJZ8_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A286Y5D6_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A1L5BWY3_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
I3MUP5_BCL2L1-03        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
I3MUP5_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
I3MUP5_BCL2L1-02        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
G1P9D2_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K5EBP4_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
E2IV75_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
F7IT34_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
F7IT34_BCL2L1-02        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q76LT7_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K5M8B1_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K5H963_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
M3XA94_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q8SQ42_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
G3RY91_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q07817_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q07817_BCL2L1-03        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K5VPG2_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
F6UKR4_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K5YR37_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2J8VIH3_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K6LPM4_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K6QFA2_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K6QFA2_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A2K6UWY8_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
E2IV77_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A452SDS4_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A384D3U1_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A452FWV3_BCL2L1-      WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q9MZS7_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q64373_BCL2L1-03        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
Q64373_BCL2L1-04        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
P53563_BCL2L1-04        WGRIVAFFSFGGALC----------VE---------------SVDKEMQ-
A0A3B1IEV7_MCL1-01      WGRIVSLVAFGAVVC----------DH---------------LKKKSRD-
A0A3B4E3I4_MCL1-03      WGRIASLVAFGAVVC----------EQ---------------MKEAGRE-
A0A3B4E3I4_MCL1-02      WGRIASLVALGAVVC----------EW---------------LKEVGRE-
A0A3B4E3I4_MCL1-01      WGRIASLVAFGAVVC----------EQ---------------MKEAGRE-
A0A3Q3B0R2_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------ASREEMT-
A0A3Q2PN77_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------ASKEGMS-
A0A1X9JZA1_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------VAKEEMA-
A0A3Q0S5Z7_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------ASNEGMT-
A0A3P8QVM8_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------ASNEGMS-
A0A3P9DIG5_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------ASNEGMS-
A0A3Q2UYW8_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------ASNEGMS-
A0A3B4G3K4_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------ASNEGMS-
A0A3Q1I5N1_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------ASKEEMT-
A0A3Q3K1K1_BCL2-01      WGRIIAFFEFGGTMC----------VEC--------------AAKEEMT-
A0A3Q3MEY1_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------AAKEEMT-
A0A3Q1FLK7_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------AAKEEMT-
A0A3Q1B8C3_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------AAKEEMT-
A0A3P8S9L3_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------AAKEEMT-
A0A3B5BBQ0_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------AAKEEMT-
A0A3B4TX71_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------AAKEEMT-
A0A3B4YAG2_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------AAKEEMT-
A0A286XUI2_BCL2A1-      WGRIVTIFAFGGVIL----------KK---------------LPREPIA-
Q564A4_BCL2-01          WGRIIAFFEFGGTMC----------VE---------------SVNREMA-
W5N4F7_BCL2-01          WGRIVAFFEFGGTMC----------VE---------------SVNREMT-
A0A3Q4MN81_BCL2L10      WGRVVSLFAFTGVLA----------RKILEQK---PGLDP--GQQQELG-
A0A3B4ETX9_BCL2L10      WGRVVSLFAFTGVLA----------RKILEQK---PGLDP--GQQQELG-
D2IT42_BCL2L10-02       WGRVVSLFTFTGVLA----------RQLQEKKGVQLGQDP--GTGRALG-
A0A3Q0S9R1_BCL2L10      WGRVVSLFAFTGVLA----------RKRLEQKP---GLDP--GQQQELG-
I3J363_BCL2L10-01       WGRVVSLFAFTGVLA----------RKILEQKP---GLDP--GQQQELG-
A0A3Q2UUP0_BCL2L10      WGRVVSLFAFTGVLA----------RKILEQKP---GLDP--RQQQELG-
A0A3P8PVZ8_BCL2L10      WGRVVSLFAFTGVLA----------RKILEQKP---GLDP--RQQQELG-
A0A3Q2UUP0_BCL2L10      WGRVVSLFAFTGVLA----------RKILEQKP---GLDP--RQQQELG-
A0A3P9BLI0_BCL2L10      WGRVVSLFAFTGVLA----------RKILEQKP---GLDP--RQQQELG-
A0A3Q2PJS5_BCL2L10      WGRVVSLFTFAGVLA----------RQLQEQQGRSPGPDP--GRQQ----
A0A3Q2GL87_BCL2L10      WGRVVSLFTFAGVLA----------RQLQEQTGKNPGLDP--GRQQELQ-
A0A3B5MJ12_BCL2L10      WGRVVSLFAFAGVLA----------RQLREQTGKNPVPDS--GKQQELQ-
M4AUW7_BCL2L10-01       WGRVVSLFAFAGVLA----------RQLREQTGKNPVPDS--GKQQELQ-
A0A096ME02_BCL2L10      WGRVVSLFAFAGVLA----------RQLREQTGKNPGPDS--GKQQELQ-
A0A3B3TYN4_BCL2L10      WGRVVSLFAFAGVLA----------RQLREQTGKNPGPDS--GKQQELQ-
A0A3B3YT99_BCL2L10      WGRVVSLFAFAGVLA----------RQLREQTGKNPGPDS--GKQQELQ-
A0A3P9NE65_BCL2L10      WGRVVSLFAFAGVLA----------RQLREQTGKNPGPDS--GKQQELQ-
A0A3P9LM07_BCL2L10      WGRVVSLFAFVGVLA----------RQLREQTDMNPGLDP----GREVA-
H2MBQ3_BCL2L10-01       WGRVVSLFAFVGVLA----------RQLREQTDMNPGLDP----GREVA-
A0A3B4AAV4_BCL2L10      WGRVVSLFTFAGVLA----------RHIKEQKSSRPGLDP--GQVQGLG-
A0A3Q3EZU5_BCL2L10      WGRVVSLFTFTGVLA----------RQLQEQEDVKLGLDP--VQGQKLG-
A0A3Q3EZU5_BCL2L10      WGRVVSLFTFTGVLA----------RQLQEQEDVKLGLDP--VQGQKLG-
A0A3Q3JQ78_BCL2L10      WGRVVSLFAFTGVLA----------RQLTEQNGMKPGLDP--GQGQELG-
A0A3B4TIY6_BCL2L10      WGRVVSIFTFTGVLA----------RLLLEQNRVNPGLDP--GQGQGLG-
A0A3B4WGF4_BCL2L10      WGRVVSIFTFTGVLA----------RLLLEQNRVNPGLDP--GQGQGLR-
A0A3Q3KZW1_BCL2L10      WGRVVSLFTFTGVLS----------RQLMEQKGMKPGLDS--GKGQELG-
A0A3B5KD08_BCL2L10      WGRVVSLFTFTGVLA----------RLMQEQKSTKPGLDP--GQEQQLG-
A0A3Q3VI28_BCL2L10      WGRVVSIFTFTGVLA----------RQLLEQKSTKPGLEPRQDQDQELG-
A0A3Q1GM98_BCL2L10      WGRVVSLFTFTGVLA----------RQLLEQKDTKPGLDP--GKRQELG-
A0A3Q1D2L0_BCL2L10      WGRVVSLFTFTGVLA----------RQLLEQKDTKLGLDP--GKQQELG-
A0A3P8RL82_BCL2L10      WGRVVSLFTFTGVLA----------RQLLEQKDTKPGLDP--GKQQELG-
A0A3B4ZFS0_BCL2L10      WGRVVSLFTFTGVLA----------RQLQEQRDTKPGLEP--GKRQELG-
A0A3B4AFB7_MCL1-01      WGRIASLIAFGAVVC----------QY---------------LKTKGRE-
B9ZYL7_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------IVNREMS-
A0A452I9V7_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
H9GPE7_BCL2-01          WGRIVAFFEFGGMLC----------VE---------------SVSREMS-
A0A3Q2HRY3_BCL2-02      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
K7F5Y4_BCL2-02          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
K7F5Y4_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
F6YNL8_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
H0YUX3_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMF-
H0W1T3_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
J9NXG3_BCL2-02          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
G1LID1_BCL2-02          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
I3MVK9_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
G1TW27_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
P10417_BCL2-02          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A096MPU7_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
P10417_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
Q7TSN8_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
Q6R755_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
Q9JJV8_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
Q923R6_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
F1LNV0_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
P49950_BCL2-01          WGRIVAFFEFGGVMC----------VG---------------SVNREMS-
H2NWH5_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A3Q2HRY3_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K6G3I7_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A287APJ6_BCL2-03      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
H0WKI0_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K5UDI5_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K5EB04_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2R8MY14_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
Q568V1_MCL1-01          WGRIASLVAFGAVVC----------SR---------------LKELQQD-
Q1L8X3_MCL1-01          WGRIASLVAFGAVVC----------SR---------------LKELQQD-
Q9I9N3_MCL1-01          WGRIASLVAFGAVVC----------SR---------------LKELQQD-
A0A3B3ICL7_BCL2L1-      WGRVVGLFVFGGALC----------VE---------------CVERNMG-
A0A3B3E2W4_BCL2L1-      WGRVVGLFVFGGVLC----------VE---------------CVERNMS-
A0A3B5B4X7_BCL2L1-      WGRIVGLFCFGGVLC----------VE---------------CVDKNMN-
A0A3B4BFZ8_BCL2L1-      WGRIVGLFVFGGVLS----------VE---------------CVEKDMS-
A0A3Q3FUB6_BCL2L1-      WGRIVGLFAFGGVLC----------VE---------------CVQKDMG-
A0A3B5MGS2_BCL2L1-      WGRVVAMFTFGGILC----------VD---------------CVQKNMS-
M4A558_BCL2L1-01        WGRVVAMFTFGGILC----------VD---------------CVQKNMS-
A0A3P9QFB3_BCL2L1-      WGRVVAMFTFGGILC----------VD---------------CVQKNMS-
A0A087YBW4_BCL2L1-      WGRVVAMFTFGGILC----------VD---------------CVQKNMS-
A0A3B3VWI7_BCL2L1-      WGRVVAMFTFGGILC----------VD---------------CVQKNMS-
A0A3B3XN57_BCL2L1-      WGRVVAMFTFGGILC----------VD---------------CVQKNMS-
A0A3Q2C6K4_BCL2L1-      WGRVVGLFAFGGVLC----------VH---------------CVQKNMS-
A0A3Q2NRP4_BCL2L1-      WGRVVGLFAFGGVLC----------VD---------------CVQKNMS-
A0A0B4KJI5_BCL2L1-      WGRVVGLFAFGGVLC----------VE---------------CVEKDTS-
A0A3Q1JZ46_BCL2L1-      WGRIVGLFAFGGVLC----------VE---------------CVEKNMS-
A0A3Q1JZ46_BCL2L1-      WGRIVGLFAFGGVLC----------VE---------------CVEKNMS-
A0A3Q3NFM4_BCL2L1-      WGRIVGLFAFGGVLC----------VE---------------CIEKNMS-
A0A3Q3NFM4_BCL2L1-      WGRIVGLFAFGGVLC----------VE---------------CIEKNMS-
A0A3B4V9K8_BCL2L1-      WGRIVGLFAFGGVLC----------VE---------------CIQKNMS-
A0A3B4XS24_BCL2L1-      WGRIVGLFAFGGVLC----------VE---------------CIQKNMS-
C1BLI0_BCL2L1-01        WGRVVGLFAFGGALC----------AE---------------CVEKDMS-
C0HAD8_BCL2L1-01        WGRVVGLFAFGGALC----------VE---------------CVEKDMS-
A0A3B3ZN55_BCL2L1-      WGRVVGLFAFGGALA----------VE---------------CVDKEMS-
A0A3B5K6B9_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B5K6B9_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
H3CH49_BCL2L1-01        WGRIVGLFAFGGALC----------VE---------------CVEKEMN-
A0A3B3TFR4_BCL2L1-      WGRVVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q2FR43_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3P8XYL5_BCL2L1-      WGRVVGLFAFGGALC----------VE---------------CVEKEMS-
Q90Z98_BCL2L1-02        WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
Q90Z98_BCL2L1-01        WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A059PJI5_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B4DTL9_BCL2L1-      WGRVVGLFAFGGALC----------VE---------------CVEKEMS-
B5XAY3_BCL2L1-01        WGRVVGLFSFGGALC----------VE---------------CVDKEMN-
W5MG74_BCL2L1-01        WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q3B3X5_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B3IB64_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3P9JYH1_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B3DHA1_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q0RTF8_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
I3IZK7_BCL2L1-01        WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A2U9BY16_BCL2L1-      WGRIIGLFAFGGALS----------VE---------------CVEKEMS-
A0A0D6DR75_BCL2L1-      WGRIIGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q3WIW8_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A219P0Y3_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q3MX20_BCL2L1-      WGRIIGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q3G2E1_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q3G2E1_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q3G2E1_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q1GZ93_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q1GZ93_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q1GZ93_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B4V3T1_BCL2L1-      WGRIIGLFVFGGALC----------VE---------------CVEKEMS-
A0A3B4XU17_BCL2L1-      WGRIIGLFVFGGALC----------VE---------------CVEKEMS-
A0A3B3QRZ2_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMG-
A0A3B3ZN55_BCL2L1-      WGRVVGLFAFGGALA----------VE---------------CVDKEMS-
G3NJY1_BCL2L1-01        WGRIVGLFAFGGALC----------VE---------------CVDKEMS-
A0A3Q3DUT7_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CMEKEMI-
A0A3Q3DUT7_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CMEKEMI-
A0A3Q3DUT7_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CMEKEMI-
A0A3B1JJ42_BCL2L1-      WGRVVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3P8UWG7_BCL2L1-      WGRIIGLFAFGGALS----------VE---------------CVEKEMS-
A0A3Q3IVF5_BCL2L1-      WGRIIGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q1DHJ3_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q1DHJ3_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q1DHJ3_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3P8TL99_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3P8TL99_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q1GS47_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B4Z3X2_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B4Z3X2_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
C3VIT1_BCL2L1-01        WGRIVGLFAFGGALC----------VE---------------CVEREMS-
A0A3P8P0F1_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q2X557_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3P9D632_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3P9D632_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q4N4B5_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B4FNX1_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q2QPL9_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B5PQJ0_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A087X9B7_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B3TUS7_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3B3WI27_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3P9N9Y4_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A3Q3BEB7_BCL2L1-      WGRVVGLFAFGGVLC----------VQ---------------CVERDMS-
A0A3P8VMA1_BCL2L1-      WGRIVGLFTFGGVLC----------VE---------------CVQRNMS-
A0A345BSW9_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A286MU87_BCL2L1-      WGRVVGLFAFGGALC----------VE---------------CVEKDMS-
A0A3P8XFS0_BCL2L1-      WGRVVGLFAFGGALC----------VE---------------CVEKDMS-
A0A3P8XFS0_BCL2L1-      WGRVVGLFAFGGALC----------VE---------------CVEKDMS-
A0A0F7L1T6_BCL2L1-      WGRVVGLFAFGGVLC----------VE---------------CVERDAS-
H2U5I3_BCL2L1-01        WGRVVGLFAFGGVLC----------VE---------------CVEKDAS-
H2U5I3_BCL2L1-02        WGRVVGLFAFGGVLC----------VE---------------CVEKDAS-
A0A3Q3J5K3_BCL2L1-      WGRIVGLFAFGGALC----------VE---------------CVEKNMS-
A0A3Q1EVP6_BCL2L1-      WGRIVGLFCFGGVLC----------VE---------------CVEKNMS-
A0A3Q1BQA0_BCL2L1-      WGRIVGLFCFGGVLC----------VE---------------CVEKNMS-
A0A3P8U812_BCL2L1-      WGRIVGLFCFGGVLC----------VE---------------CVDKNMS-
E6ZFR0_BCL2L1-01        WGRIVGLFAFGGVLC----------VE---------------CVEKDMS-
G3P7B4_BCL2L1-01        WGRVVGLFAFGGVLC----------VE---------------CVEKDMT-
A0A3Q3X5M5_BCL2L1-      WGRIVGLFAFGGVLC----------VE---------------CAEKDTG-
A0A2U9BIG9_BCL2L1-      WGRIVGLFAFGGVLC----------VE---------------CVEKNRG-
A0A3B3C5I4_BCL2L10      WGRVVSLFAFVGVLA----------RQLREQTDTNPGL----DLGREAA-
A0A3Q2Y539_MCL1-01      WGRIASLLAFCAVLS----------QA---------------LKENQQE-
H3AR18_MCL1-02          WGRIVSLIAFGAVVA----------KK---------------LKKMNLE-
A0A3B1K5R1_MCL1-01      WGRVASLVAFGAVVS----------KH---------------QHDMGRG-
A0A3B4C6H5_MCL1-01      WGRIASLLAFGAVVC----------QH---------------QNQMGRG-
A0A3B4C6H5_MCL1-02      WGRIASLLAFGAVVC----------QH---------------QNQMGRG-
A0A3B4C6H5_MCL1-03      WGRIASLLAFGAVVC----------QH---------------QNQMGRG-
A0A3Q1IAB0_BCL2L10      WGRVVSLFTFTGVLA----------RQMLEQKDKKPGLDL--GKGQELG-
Q5XGJ4_BCL2L2-01        WGRIVAFFVFGAALC----------AE---------------SVNKEMS-
A0A3P8WUE9_BCL2-01      WGRIIAFFEFGGVVC----------VEC--------------AAKEDLT-
A0A3Q3G1D7_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------MSKQEMT-
A0A3B4A3G8_BCL2-01      WGRIIAFFEFGGTVC----------VEC--------------ASKEDMS-
D2ITA2_BCL2L1-02        WGRIVGLFAFGGALC----------VE---------------CVEKEMS-
A0A452FIG6_BCL2L1-      WDHTVAFFSFRGALC----------ME---------------SVDKEMQ-
A0A452FIG6_BCL2L1-      WDHTVAFFSFRGALC----------ME---------------SVDKEMQ-
Q8UWD6_MCL1-01          WGRIASLLTFGAMLC----------KY---------------QNDRGHS-
F8W4Q8_MCL1-01          WGRIASLLTFGAMLC----------KY---------------QNDRGHS-
Q568W5_MCL1-01          WGRIASLLTFGAMLC----------KY---------------QNDRGHS-
M3Y8D1_BCL2L10-01       WGRVVALVTFAGTLL----------ERPPSGACSNLGPDP--ELELELG-
H3ANS8_BCL2L1-01        WGRVVAFFAFGGALC----------VE---------------SMDKEMS-
F7G6M3_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
G1TV33_BCL2L2-01        WGRVVAFFAFGAALC----------AE---------------SVNKEME-
A0A2K5CWZ4_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2R8M4C0_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
G3TMU7_BCL2L2-01        WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K5CWZ4_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A2K6TM77_BCL2L2-      WGRLVAFFVFGAALC----------AE---------------SVNKEME-
A0A3P8W7K5_BCL2L10      WGRVVSIFTFTGVLA----------KQLLVQKGLKPGQEP--EAGQELG-
A0A3B3ICL7_BCL2L1-      WGRVVGLFVFGGALC----------VE---------------CVERNMG-
A0A452U2H8_BCL2A1-      WGRIVTIFAFEGILT----------KK---------------LLQERIS-
A0A452U2H8_BCL2A1-      WGRIVTIFAFEGILT----------KK---------------LLQERIS-
F7BXJ7_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A3B3TCS4_BCL2-01      WGRIVAFLEFGGTMC----------VE---------------SVNREMT-
H0Z8G3_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVVKEMR-
U3JSL7_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVVKEMR-
Q4U2V6_BCL2L1-01        WGRIVAFFSFGGALC----------VE---------------SVVKEMR-
A0A3P8YNB4_BCL2-01      WGRIIAFFEFGGTIC----------VE---------------CVNKEMT-
A0A3P9AAB2_BCL2-01      WGRIVAFLEFGGTMC----------VE---------------SVNREMT-
A0A0U3DHY6_BCL2-01      WGRIVAFFEFGGTMC----------VE---------------SVNREMT-
X4ZGI8_BCL2-01          WGRIVAFFEFGGTMC----------VE---------------SFNREMA-
U3KEW4_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
Q00709_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
K7F5Y4_BCL2-03          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
G3WZW9_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A452R145_BCL2-02      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
M3YYK3_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
P10415_BCL2-04          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K6R2I6_BCL2-02      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
J9NXG3_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A1D5QRF2_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2R9APW6_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
G3ULB7_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A9QXG9_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K5NZS5_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A0D9S017_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K6CIX3_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K5XRD4_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K6KHG1_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K6R2I6_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K5HK49_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
G3QES9_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2I3GZF9_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2K6UEL3_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
P10415_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
P10415_BCL2-02          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
H2QEM8_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A2U4BHU7_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
Q75SV7_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
M3X1R9_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A076FU27_BCL2-01      WGRIVAFFEFGGVIC----------VE---------------SVNREMS-
F6R2C4_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
O02718_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A076FZV9_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A452EV13_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
G1LID1_BCL2-01          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A452R145_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
G3WZW9_BCL2-02          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
G3ULB7_BCL2-02          WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
A0A452T603_BCL2-01      WGRIVAFFEFGGVMC----------VE---------------SVNREMS-
G3PJT0_MCL1-01          WGRIASLVAFGAVVC----------QH---------------LAERGRG-
A0A3Q3VP02_MCL1-01      WGRIASLVAFGVVVS----------QC---------------LKENGKS-
A0A3B5K5B3_MCL1-01      WGRIASLVAFGAVVA----------QH---------------MKDNGRR-
H2MLZ3_MCL1-01          WGRIVSLLAFGAAVC----------QS---------------LKEKGRG-
H2MLZ3_MCL1-02          WGRIVSLLAFGAAVC----------QS---------------LKEKGRG-
A0A3B3CEX1_MCL1-02      WGRIASLLAFGAAVC----------LQ---------------LKEKGRG-
A0A3B3CEX1_MCL1-01      WGRIASLLAFGAAVC----------LQ---------------LKEKGRG-
A0A3Q3B4V7_MCL1-01      WGRISSLVAFGAVVA----------VH---------------LKEKGRE-
A0A3Q3B4V7_MCL1-02      WGRISSLVAFGAVVA----------VH---------------LKEKGRE-
A0A3Q2EDX8_MCL1-01      WGRIVSLVAFGAVVC----------QH---------------LKEKGRE-
A0A3Q2T2A9_MCL1-02      WGRIASLVAFGAVLC----------QH---------------LKESGRS-
A0A3Q2T2A9_MCL1-01      WGRIASLVAFGAVLC----------QH---------------LKESGRS-
A0A3B5PQ55_MCL1-02      WGRIASLVTFGAAVC----------QR---------------LKERGRE-
A0A3B5PQ55_MCL1-01      WGRIASLVTFGAAVC----------QR---------------LKERGRE-
A0A3P9Q4R7_MCL1-02      WGRIVSLVAFGAVVC----------QH---------------LKERGRE-
A0A3P9Q4R7_MCL1-01      WGRIVSLVAFGAVVC----------QH---------------LKERGRE-
A0A087X830_MCL1-01      WGRIVSLVAFGAAVC----------QH---------------LKERGRE-
A0A3B3YCD0_MCL1-01      WGRIVSLVAFGAAVC----------QH---------------LKERGRE-
A0A3P8VKS9_MCL1-02      WGRITSLVAFGAVVC----------QH---------------LKECGQE-
A0A3P8VKS9_MCL1-01      WGRITSLVAFGAVVC----------QH---------------LKECGQE-
A0A3P8VKS9_MCL1-05      WGRITSLVAFGAVVC----------QH---------------LKECGQE-
A0A3P8VKS9_MCL1-04      WGRITSLVAFGAVVC----------QH---------------LKECGQE-
A0A3P8VKS9_MCL1-03      WGRITSLVAFGAVVC----------QH---------------LKECGQE-
I3JHR5_MCL1-01          WGRIVSFVAFGAVVS----------QH---------------LKEKGRD-
A0A3Q4HLQ8_MCL1-01      WGRVVSFVAFGAVVS----------QH---------------LKEKGRD-
A0A3P8NP63_MCL1-02      WGRIVSFMAFGAVVS----------QH---------------LKEKGRD-
A0A3P8NP63_MCL1-03      WGRIVSFMAFGAVVS----------QH---------------LKEKGRD-
A0A3Q2VNL8_MCL1-01      WGRIVSFMAFGAVVS----------QH---------------LKEKGRD-
A0A3P8NP63_MCL1-01      WGRIVSFMAFGAVVS----------QH---------------LKEKGRD-
A0A3P9BVM3_MCL1-01      WGRIVSFMAFGAVVS----------QH---------------LKEKGRD-
A0A3B4G4Z6_MCL1-01      WGRIVSFMAFGAVVS----------QH---------------LKEKGRD-
A0A2U9CJ81_MCL1-01      WGRVSSLVAFGAVVS----------QH---------------LKETGRG-
A0A3Q3IZW0_MCL1-01      WGRITSLLAFGAVVC----------QY---------------LKEKGRE-
A0A3Q1GX28_MCL1-02      WGRIASLVAFGAAVC----------QH---------------LKEKHRE-
A0A3Q1GX28_MCL1-01      WGRIASLVAFGAAVC----------QH---------------LKEKHRE-
A0A3B4XKA5_MCL1-01      WGRIASLVAFGVVVC----------QH---------------MKDTGRE-
A0A3Q3GP42_MCL1-01      WGRIASLVAFGAAVS----------QY---------------LKENGRG-
A0A3Q3M6G2_MCL1-02      WGRIASLVAFGAVVC----------QY---------------LKEKGRG-
A0A3Q3M6G2_MCL1-01      WGRIASLVAFGAVVC----------QY---------------LKEKGRG-
W5MMB7_MCL1-01          WGRIASLVSFGAVVA----------KQ---------------MKDSGRE-
A0A3B3R4U0_MCL1-01      WGRIASLIAFGGVVC----------KY---------------LKDHGQT-
A0A3B3SG34_MCL1-01      WGRIASLVAFGAEVC----------KY---------------LKETGRE-
Q4SW32_MCL1-01          WGRVASLLAFAAVVA----------QY---------------LNDHGQR-
D2ITA0_MCL1-03          WGRIASLVAFGAALC----------QY---------------LEARGKE-
D2ITA0_MCL1-04          WGRIASLVAFGAALC----------QY---------------LEARGKE-
Q0KFR9_MCL1-01          WGRIASLVAFGAVVS----------QH---------------LKERGRG-
A0A3P8Y1W8_MCL1-01      WGRIASLVGFGAVVS----------QH---------------LKEMGKG-
A0A3P8Y1W8_MCL1-02      WGRIASLVGFGAVVS----------QH---------------LKEMGKG-
A0A3Q2XZL8_MCL1-01      WGRVASLVAFGAIVS----------QH---------------LKEKGRA-
A0A3B4AFB7_MCL1-02      WGRIASLIAFGAVVC----------QY---------------LKTKGRE-
A0A3B3VM25_MCL1-01      WGRIVSLVAFGAAVC----------QH---------------LKERGRE-
A0A3Q0RA11_MCL1-03      WGRIASLMAFGAVVC----------QR---------------LKEKGRD-
A0A3Q0RA11_MCL1-01      WGRIASLMAFGAVVC----------QR---------------LKEKGRD-
A0A3B4T8L9_MCL1-02      WGRIASLVAFGAVVC----------QR---------------MKETGRE-
A0A3B4T8L9_MCL1-01      WGRIASLVAFGAVVC----------QR---------------MKETGRE-
A0A3Q1EQB9_MCL1-02      WGRITSLVAFGAVVC----------QY---------------LKERGRE-
A0A3B4ZKP6_MCL1-01      WGRITSLVAFGAVVC----------QY---------------LKERGRE-
A0A3Q1BKL8_MCL1-02      WGRITSLVAFGAVVC----------QY---------------LKERGRE-
A0A3Q1EQB9_MCL1-01      WGRITSLVAFGAVVC----------QY---------------LKERGRE-
A0A3Q1BKL8_MCL1-01      WGRITSLVAFGAVVC----------QY---------------LKERGRE-
A0A3P8RQX7_MCL1-02      WGRITSLVAFGAVVC----------QY---------------LKERGRE-
A0A3P8RQX7_MCL1-01      WGRITSLVAFGAVVC----------QY---------------LKERGRE-
U3JTB2_BCL2A1-01        WGRIMTIFTFGGLLT----------K----------------KLQEHGV-
H0ZCL9_BCL2A1-01        WGRIMTIFTFGGLLT----------K----------------KLQEHGV-
Q9W6F2_BCL2A1-01        WGRIMTIFTFGGLLT----------K----------------KLQEHGV-
G1N8C5_BCL2A1-01        WGRIMTIFTFGGLLT----------K----------------KLQEQGV-
A0A452J3N6_BCL2A1-      WGRILTIFMFGGILS----------K----------------KLQEHRV-
K7G130_BCL2A1-01        WGRILTIFMFGGILS----------K----------------RLQEHKV-
F6SFL4_BCL2A1-01        WGRIVTIFAFGGILI----------K----------------KLLRHRA-
G3WSP8_BCL2A1-01        WGRIVTIFAFGGILI----------K----------------KLLRHRA-
F6S8G3_BCL2A1-01        WGRIVTIFVLGGILT----------K----------------KLQRSGV-
G1T1L8_BCL2A1-01        WGRIVTIFAFEGVLA----------K----------------KLLQEQA-
O55178_BCL2A1-01        WGRIVTIFAFGGVLL----------K----------------KTSTRAD-
Q0P538_BCL2A1-01        WGRIVTIFAFGGVLL----------K----------------KTSTRAD-
A0A337STN9_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLQERI-
A0A337STN9_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLQERI-
E2RS00_BCL2A1-01        WGRIVTVFAFEGILT----------K----------------KLLEQRI-
M3YVH4_BCL2A1-01        WGRIVTVFAFEGILS----------K----------------KLLRERI-
A0A452SIR9_BCL2A1-      WGRIVTIFAFEGILT----------K----------------KLLQERI-
G3V977_BCL2A1-01        WGRIVTIFAFGGVLL----------K----------------KLPQEQI-
Q925A9_BCL2A1-01        WGRIVTIFAFGGVLL----------K----------------KLPQEQI-
Q07440_BCL2A1-01        WGRIVTIFAFGGVLL----------K----------------KLPQEQI-
O55179_BCL2A1-01        WGRIVTIFAFGGVLL----------K----------------KLPQEQI-
O55177_BCL2A1-02        WGRIVTIFAFGGVLL----------K----------------KLPQEQI-
Q497M6_BCL2A1-01        WGRIVTIFAFGGVLL----------K----------------KLPQEQI-
Q8K164_BCL2A1-01        WGRIVTIFAFGGVLL----------K----------------KLPQEQI-
Q4FK02_BCL2A1-01        WGRIVTIFAFGGVLL----------K----------------KLPQEQI-
I3MCZ7_BCL2A1-01        WGRIVTIFAFGGVLV----------K----------------KLLRERI-
G3T8E6_BCL2A1-01        WGRIVTIFAFGGILI----------K----------------KLLRERI-
H0WZ23_BCL2A1-01        WGRIVTIFAFGGILL----------K----------------KLLQQRI-
A0A2K6TLM0_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRERI-
A0A2K5D2I1_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRERI-
U3DBA0_BCL2A1-02        WGRIVTIFAFEGILI----------K----------------KLLRERI-
A0A2K6TLM0_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRERI-
B4E1X9_BCL2A1-01        WGRIVTIFAFEGILI----------K----------------KLLRQQI-
Q16548_BCL2A1-02        WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2I2YML2_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2R8ZJX9_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2I3T6T8_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2I3HNF3_BCL2A1-      WGRIVTIFAFEGILV----------K----------------KLLRQRT-
A0A2K6PHG5_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2K6LV22_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
F7E8V5_BCL2A1-02        WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K5KHH9_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K6AD55_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K5TMD8_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K5KAB6_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K6DS80_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A096NMX5_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K6EKG1_BCL2A1-      WGRIVTVFAFGGILI----------K----------------KLLREQI-
Q3C2I0_BCL2A1-01        WGRIVTIFAFEGILT----------K----------------KLLGKCI-
A0A452EK63_BCL2A1-      WGRIVTIFAFEGILT----------K----------------KLLSKRI-
W5Q0N6_BCL2A1-01        WGRIVTIFAFEGILT----------K----------------KLLSKRI-
F7CP56_BCL2A1-01        WGRIMTIFAFEGILI----------K----------------KLLPERI-
C7F841_BCL2A1-02        WGRIVTIFAFEGILM----------K----------------KLLRKRI-
C7F841_BCL2A1-01        WGRIVTIFAFEGILM----------K----------------KLLRKRI-
A0A2I3HNF3_BCL2A1-      WGRIVTIFAFEGILV----------K----------------KLLRQRT-
A0A2I2YML2_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2R8ZJX9_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2I3T6T8_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
H2NNZ9_BCL2A1-01        WGRIVTIFAFEGILI----------K----------------KLLRQQI-
Q16548_BCL2A1-01        WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2I2YML2_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2K6LV22_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2K6PHG5_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2R8ZJX9_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2I3T6T8_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQQI-
A0A2I3HNF3_BCL2A1-      WGRIVTIFAFEGILV----------K----------------KLLRQRT-
A0A2K5KHH9_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K5KHH9_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K5KAB6_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K5TMD8_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
F7E8V5_BCL2A1-01        WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K6DS80_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K6AD55_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A096NMX5_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A0D9RRC3_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRQRI-
A0A2K5D2I1_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRERI-
U3DBA0_BCL2A1-01        WGRIVTIFAFEGILI----------K----------------KLLRERI-
A0A2K6TLM0_BCL2A1-      WGRIVTIFAFEGILI----------K----------------KLLRERI-
R4JQR8_BCL2L1-01        WGRIVALFGFGGSL----------------------------SVKCVQR-
A0A346RRN1_BCL2L1-      WGRVVALFGFGGAL----------------------------SVECVQN-
Q99M66_BCL2L10-01       WGRLVMLLAFVGTLM----------NQDRTV-----------KRRRDQR-
F6ZPD4_BCL2L10-01       WGRVAALVTLAGTLL----------ERAPRGTYRKPKRGYKLELREWKA-
Q9Z0F3_BCL2L10-01       WSQLVMLLAFAGTLM----------NQGPYMAV---------KQKRDLG-
E1B9B3_BCL2L10-01       WGRVASLVTFAGSLL----------ERPPQTTRR--------QEKRDDD-
F1RZB9_BCL2L10-01       WYRVASLLTFAGMLL----------ERHPREAC---------GRKKKEG-
G1T264_BCL2L10-01       WGRVVTLVTFAGTLL----------DRGPPVTT----------QRVRRN-
F1MV39_BCL2L10-01       WGRVASLVTFAGSLL----------ERPPQTTR---------RQKRDDD-
W5QIG4_BCL2L10-01       WGRVASLVTFAGSLL----------ERQPQTTR---------RQKRDDG-
A0A2K6F2Q2_BCL2L10      WGRVVMLVTFAGTLL----------ERGPPVTAWWKKWGLQPQPKEGDP-
H0WZ06_BCL2L10-01       WGRVVTLVTFAGTLL----------QRPPVEARREKQD--KSQLKEGED-
A0A2K6TIT7_BCL2L10      WGNVVMLLAFAGTLL----------ERGPLVTARWKKWGFQSRLKEPEG-
A0A2K5F974_BCL2L10      WGNVVMLLAFAGTLL----------ERGPLVTARWKKWGFQSRLKEPEG-
F7CT87_BCL2L10-01       WGNVVMLLAFAGTLL----------ERGPLVTARWKKWGFQSRLKEPEG-
A0A0D9RG38_BCL2L10      WGRVVSLVTFAGTLL----------EREPLMTAWWKKQSFQPRL-EQEG-
A0A096NM44_BCL2L10      WGRVVSLVTFAGTLL----------EREPLVTAWWKKRSFQPRLKEQEG-
A0A2K6R5T5_BCL2L10      WGRVVSLVTFAGTLL----------EREPLVTAWWKKRSFQPRLKEQEG-
Q9HD36_BCL2L10-02       WGRVVTLVTFAGTLL----------ERGPLVTARWKKWGFQPRLKEQEG-
G1R3W6_BCL2L10-01       WGRVVTLVAFAGTLL----------ERGPLVTARWKKWGFQPRLKEQEG-
A0A2K5K3B0_BCL2L10      WGRVVSLVTFAGTLL----------EREPLVTAWWKKRSFQPRLKEQEG-
A0A2K6M5H5_BCL2L10      WGRVVSLVTFAGTLL----------EREPLVTAWWKKRSFQPRLKEQEG-
A0A2K5TKG9_BCL2L10      WGRVVSLVTFAGTLL----------EREPLVTAWWKKRGFQPRLKEQEG-
F7H6U5_BCL2L10-01       WGRVVSLVTFAGTLL----------EREPLVTAWWKKRGFQPRLKEQEG-
A0A2K6B2D9_BCL2L10      WGRVVSLVTFAGTLL----------EREPLVTAWWKKRGFQPRLKEQEG-
A0A2K5MMZ4_BCL2L10      WGRVVSLVTFAGTLL----------EREPLVTAWWKKRGFQPRLKEQEG-
H2NN92_BCL2L10-01       WGRVVTLVTFAGTLL----------ERGPLVTARWKKWGFQPRLKEQEG-
G3QLU6_BCL2L10-01       WGRVVTLVTFAGTLL----------ERGPLVTARWKKWGFQPRLKEQEG-
A0A2R9BCD9_BCL2L10      WGRVVTLVTFAGTLL----------ERGPLVTTRWKKWGFQPRLKEQEG-
H2Q9G4_BCL2L10-01       WGRVVTLVTFAGTLL----------ERGPLVTTRWKKWGFQPRLNEQEG-
Q9HD36_BCL2L10-01       WGRVVTLVTFAGTLL----------ERGPLVTARWKKWGFQPRLKEQEG-
A0A337RYG8_BCL2L10      WGHVVALLTFAGTLL----------ERPPPGTYLNLTPDQQQEL-EWET-
G1LKR4_BCL2L10-01       WGRVVALLTFAGTLL----------ERSPSGTYSNLGPDQELELGEWEA-
A0A452QJG0_BCL2L10      WGRVVALLTFAGTLL----------ERSPSGTYSNLGPDQELELGEREA-
P70345_BCL2L2-03        W-------------------------------------------------
A0A2I3T6T8_BCL2A1-      W-------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------PLVDN--------IATWMTEYLNRHLHNWIQD-NGGW-----
A0A3Q0RA11_MCL1-02      ----N---CV---------ELVSQEISTYLLSDQRDWLVK-NNAW-----
I3KXG5_MCL1-01          ----N---CV---------VLVSQEISAYLLSEQRDWIIK-NNAW-----
U3KKY6_MCL1-01          --------QSITS--------LAGIITDALVSSKRQWLES-QGGW-----
G1MPY7_MCL1-01          --------KCISS--------LAGIITDALVSSKREWLMS-QGGW-----
K7FPN7_MCL1-01          --------NCINT--------LAGIITDVLVSDKRDWLVN-QRGW-----
F6VJQ0_BCL2L10-01       ----Q---VL--QLRRETSRRLTEKLCNYLVERKGAWLHE-NGGW-----
A0A3Q1GS47_BCL2L1-      ----P---LV--G-------RIVEWMTVYLDNHIQDWIQG-QGGW-----
A0A2K5DMS4_MCL1-01      ----S---CI--E-------PLAESI-------------R-YSRW-----
A0A3P8V8T6_MCL1-01      ----N---TV--D-------QVGQEIASYLLSYQKDWLLK-NNSW-----
B6V6J0_MCL1-01          ----D---CI--G-------VLAEHFTQFLMMSKKDWIIQ-EKGW-----
F7ETY1_MCL1-01          ----D---CI--M-------ALAEHFTLFLMTSKKDWIIQ-EKGW-----
A0A287APJ6_BCL2-01      YML-S---SL--T-------CGMAPVTSITEGLQQDAFVE-LYGP-----
H3AR18_MCL1-01          ----D---SI--E-------QLAVSITDFLVQNKGDWILK-NQGW-----
F7G4L5_BCL2L2-04        ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6GWN0_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2R8M4C0_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2K5CWZ4_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2I2YPX6_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6TM77_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
W5QDH5_BCL2L2-01        ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
D3Z5F7_BCL2L2-01        ----P---LV--G-------QVQDWMVAYLETRLADWIHS-SGGW-----
A0A2K6MEE6_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6RW46_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A384DPS8_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2K5MZX9_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2K5HEK7_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2K5V0Q3_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
F7G4L5_BCL2L2-05        ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6EA73_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6AI30_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
G1RYB4_BCL2L2-01        ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2R9A7B2_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
H2Q805_BCL2L2-02        ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A2I3MUE4_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
A0A287AW74_BCL2L2-      ----P---LV--G-------QVQEWMVTYLETRLADWIHS-SGGW-----
A0A384DPS8_BCL2L2-      ----P---LV--G-------QVQEWMVAYLETRLADWIHS-SGGW-----
J7H260_MCL1-01          ----N---CV--G-------ILADSFTDYLMTQKKEWIVE-HNGW-----
H0XHA5_MCL1-01          ----G---YI--K-------PLEENIADVLVRTKPDWLVK-QRGW-----
R4GAJ0_MCL1-01          ----N---AI--N-------TLIEIITDVLVTDKREWLLK-HNAW-----
R4GAJ0_MCL1-02          ----N---AI--N-------TLIEIITDVLVTDKREWLLK-HNAW-----
G1QAV8_MCL1-01          ----S---CI--E-------PLAEDITDVLVGTERGWLVK-QRGW-----
A0A2K6F6N9_MCL1-01      ----S---CI--E-------PLAESITDILVRTKRDWL------------
M3XAP4_MCL1-03          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K6GI15_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
C8YZ26_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5CFH3_MCL1-02      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
F7GTF7_MCL1-03          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K6V5Y3_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5LXU8_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5I9Q7_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2I2YQH7_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
Q07820_MCL1-04          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5W0W9_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
F7HUE9_MCL1-02          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K6ECR0_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5XSC7_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2R9BYH6_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
K7DE58_MCL1-03          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2I3M3D6_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K6KRW9_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K6PPL1_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
K7DE58_MCL1-04          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2I3GB35_MCL1-03      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
G2HFR3_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A1L1RNM6_MCL1-01      ----K---CI--T-------SLAGIITDALVSSKREWLMS-QGGW-----
A0A1L1RNM6_MCL1-02      ----K---CI--T-------SLAGIITDALVSSKREWLMS-QGGW-----
F6ZMX1_MCL1-01          ----S---CI--D-------PLAESITDVLVKTKRDWLIK-QKGW-----
A0A286Y1M5_MCL1-01      ----S---CI--E-------PLAESITDALVHSKRDWLVK-QRGW-----
P97287_MCL1-02          ----S---FI--E-------PLAETITDVLVRTKRDWLVK-QRGW-----
P97287_MCL1-01          ----S---FI--E-------PLAETITDVLVRTKRDWLVK-QRGW-----
G3T756_MCL1-01          ----S---RI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
G1L3M8_MCL1-02          ----G---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2U3V2H3_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
K9IWB2_MCL1-03          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
K9IWB2_MCL1-02          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
K9IWB2_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
B4DU51_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A287DCH9_MCL1-02      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A287DCH9_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A452GAH0_MCL1-02      ----S---CI--E-------PLAESITDVLVRSKRDWIVK-QRGW-----
A0A2K5I9Q7_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
G1PZ39_MCL1-01          LAMSH---CF--R-------PPDSLGTALRSKAGKVWETS-NTCH-----
Q95KR3_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5EPY9_MCL1-02      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5EPY9_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
J9PBC4_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5C7L5_MCL1-01      ----K---CA--A-------GFCRCCWS------RSWF------------
Q9Z1P3_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A5PJR2_MCL1-01          ----S---CI--E-------PLAESITDVLVRSKRDWIVK-QRGW-----
A0A452GAH0_MCL1-01      ----S---CI--E-------PLAESITDVLVRSKRDWIVK-QRGW-----
G1L3M8_MCL1-01          ----G---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
F7AVA6_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
G1T2Q0_MCL1-02          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
G1T2Q0_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
M3XAP4_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
Q7YRZ9_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
J9PBC4_MCL1-02          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
Q8HYS5_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
M3XZZ5_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A452RHX5_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
H0XFB7_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K6GI15_MCL1-02      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
F7GTF7_MCL1-02          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5CFH3_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K6V5Y3_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K6KRW9_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K6PPL1_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5XSC7_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A0D9RZP5_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5W0W9_MCL1-02      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
I7G687_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
F7HUE9_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K6ECR0_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2I3M3D6_MCL1-02      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5LXU8_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2I3GB35_MCL1-02      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
H2N5Y9_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
Q07820_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2R9BYH6_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
K7DE58_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2I2YQH7_MCL1-01      ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
A0A2K5I9Q7_MCL1-02      ----K---CA--A-------GFCRCCWS------RSWF------------
M3XAP4_MCL1-02          ----K---CA--A-------GFCRCCWS------RSWF------------
A0A2K6GI15_MCL1-01      ----K---CA--A-------GFCRCCWS------RSWF------------
F7GTF7_MCL1-01          ----K---CA--A-------GFCGCCWS------RSWV------------
A0A2K5CFH3_MCL1-03      ----K---CA--A-------GFCRCCWS------RSWF------------
A0A2K6V5Y3_MCL1-02      ----K---CA--A-------GFCRCCWS------RSWF------------
A0A2K6KRW9_MCL1-02      ----K---CA--A-------GFCRCCWS------RSWF------------
A0A2K6PPL1_MCL1-02      ----K---CA--A-------GFCRCCWS------RSWF------------
A0A2K5LXU8_MCL1-02      ----K---CA--A-------GCCRCCWS------RSWF------------
A0A2K5W0W9_MCL1-01      ----K---CA--A-------GFCRCCWS------RSWF------------
A0A2K6ECR0_MCL1-02      ----K---CA--A-------GFCRCCWS------RSWF------------
A0A2I3M3D6_MCL1-01      ----K---CA--A-------GFCRCCWS------RSWF------------
A0A2K5XSC7_MCL1-02      ----K---CA--A-------GFCRCCWS------RSWF------------
A0A2I3GB35_MCL1-01      ----K---CA--A-------GFCRCCWS------RSWF------------
Q07820_MCL1-03          ----E---CA--A-------GFCRCCWS------RSWF------------
A0A2R9BYH6_MCL1-02      ----E---CA--A-------GFCRCCWS------RSWF------------
K7DE58_MCL1-02          ----E---CA--A-------GFCRCCWS------RSWF------------
A0A2I2YQH7_MCL1-02      ----E---CA--A-------GFCRCCWS------RSWF------------
G3WBC5_MCL1-01          ----S---CI--D-------PLAESITDVLVKSKRDWLMK-QKGW-----
W5QI41_MCL1-01          ----S---CI--E-------PLAESITDVLVRSKRDWIVK-QRGW-----
F1MQX4_MCL1-01          ----S---CI--E-------PLAESITDVLVRSKRDWIVK-ERGW-----
B4DLY8_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
B4DG83_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
B4E3L8_MCL1-01          ----S---CI--E-------PLAESITDVLVRTKRDWLVK-QRGW-----
F8W4Q8_MCL1-02          ----H----------SKYVRLVGEEISSYLLTEQRDWILR-NKAW-----
G1QEX2_BCL2L10-01       ----A---TVDQDCQR-----LVTFLCSWLTETHRTWMEA-QGGW-----
H3AAS7_BCL2L2-02        ----S---LV--G--R-----IIDWTVTYVESSLQDWINH-SGGW-----
H3AAS7_BCL2L2-01        ----S---LV--G--R-----IIDWTVTYVESSLQDWINH-SGGW-----
F6TEC3_BCL2L2-01        ----P---LL--P--R-----IQDWMVTYLETNLRDWIQS-NGGW-----
G1Q051_BCL2L2-01        ----P---LV--G--Q-----VQEWTVAYLEMRLADWIHS-IGGW-----
G3WPT2_BCL2L2-01        ----P---LV--G--Q-----EKRYGVHLKQGILARYLPS-KAGA-----
P70345_BCL2L2-01        ----P---LV--G--Q-----VQDWMVAYLETRLADWIHS-SGGW-----
O88996_BCL2L2-01        ----P---LV--G--Q-----VQDWMVTYLETRLADWIHS-SGGW-----
A0A3Q9B4M8_BCL2L2-      ----P---LV--G--Q-----VPEWMVTYLETRLADWIHS-SGGW-----
H0XR82_BCL2L2-01        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
Q92843_BCL2L2-02        ----P---LV--G--Q-----VQEWMVAYLETQLADWIHS-SGGW-----
Q05KI8_BCL2L2-01        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
Q1RMX3_BCL2L2-01        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
Q45T69_BCL2L2-01        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A452ECF0_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A286XQQ9_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K5MZX9_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A0D9RU30_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K5HEK7_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
F6PH48_BCL2L2-01        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2I2UAE3_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2I2YPX6_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
I3ND50_BCL2L2-01        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K5V0Q3_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
F7G4L5_BCL2L2-02        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
F7G4L5_BCL2L2-03        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6EA73_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6AI30_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
G1RYB4_BCL2L2-03        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2R9A7B2_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
H2Q805_BCL2L2-01        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2I3MUE4_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6GWN0_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6MEE6_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6RW46_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6RW46_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6TM77_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A287AW74_BCL2L2-      ----P---LV--G--Q-----VQEWMVTYLETRLADWIHS-SGGW-----
A0A2U4CFE3_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A452SHI1_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A384DPS8_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
F6U940_BCL2L2-01        ----P---LV--G--Q-----VQDWMVTYLETQLADWIHS-SGGW-----
G3WPT2_BCL2L2-02        ----P---LV--G--Q-----VQDWMVTYLETQLADWIHS-SGGW-----
W5QDH5_BCL2L2-02        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
Q7TS60_BCL2L2-01        ----P---LV--G--Q-----VQDWMVTYLETRLADWIHS-SGGW-----
G1LMC3_BCL2L2-01        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
M3Y5X5_BCL2L2-01        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
G1P3J2_BCL2L2-01        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
I3ND50_BCL2L2-02        ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
P70345_BCL2L2-04        ----P---LV--G--Q-----VQDWMVAYLETRLADWIHS-SGGW-----
Q6GLI5_BCL2L1-01        ----E---LL--P--R-----IVQWMVQYLEHTLQPWMLE-NGGW-----
Q2TAP5_BCL2L1-01        ----D---LL--P--R-----IVQWMVNYLEHTLQPWMQE-NGGW-----
Q91828_BCL2L1-01        ----D---LL--P--R-----IVQWMVNYLEHTLQPWMQE-NGGW-----
I7GKS6_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K5EBP4_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K6UWY8_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A3Q1LRT3_BCL2L1-      ----V---LV--S--Q-----VTTSTATYLNNHLKPWIQE-NGGW-----
A0A2K5M8B1_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K5H963_BCL2L1-      ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
G3RY91_BCL2L1-02        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K5VPG2_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
F6UKR4_BCL2L1-02        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K5YR37_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K6LPM4_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K6QFA2_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K6G3C5_BCL2L1-      ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
H9GHK7_BCL2L1-01        ----G---LV--V--R-----IASWMTTYLTEHLDPWIQE-NGGW-----
Q07816_BCL2L1-04        ----Q---MA--P--HRGDRGRSASAGIPAEPQVTPWLCPLAPGW-----
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      ----V---LV--S--Q-----VTTWMATYLNNHLEPWIQE-NGDW-----
W5PSA5_BCL2L1-01        ----V---LV--S--Q-----VTTWMATYLNDHLEPWIQE-NGDW-----
Q07816_BCL2L1-01        ----V---LV--G--R-----IVSWMTTYLTDHLDPWIQE-NGGW-----
Q07816_BCL2L1-03        ----V---LV--G--R-----IVSWMTTYLTDHLDPWIQE-NGGW-----
Q07816_BCL2L1-02        ----V---LV--G--R-----IVSWMTTYLTDHLDPWIQE-NGGW-----
G1N5N5_BCL2L1-01        ----V---LV--G--R-----IVSWMTTYLTDHLDPWIQE-NGGW-----
A0A452ILL8_BCL2L1-      ----V---LV--G--R-----IVSWMTTYLTDHLDPWIQE-NGGW-----
A0A452ILL8_BCL2L1-      ----V---LV--G--R-----IVSWMTTYLTDHLDPWIQE-NGGW-----
K7F655_BCL2L1-01        ----V---LV--G--R-----IASWMTTYLTDHLDPWIQE-NGGW-----
A0A287CZ07_BCL2L1-      ----V---LV--S--R-----IASWM---------PWIQE-NGGW-----
F6WA14_BCL2L1-01        ----V---LV--G--R-----ITSWMATYLDDHLDPWIQE-NGGW-----
G3WKX6_BCL2L1-01        ----V---LV--A--R-----ITSWMATYLDEHLDPWIQE-NGGW-----
F6WQI0_BCL2L1-02        ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGWKETAL
G3SPN0_BCL2L1-01        ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
H0X6V2_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
Q2PFS6_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
P53563_BCL2L1-02        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
P53563_BCL2L1-03        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
O35843_BCL2L1-01        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
G1RER8_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
Q64373_BCL2L1-01        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
Q64373_BCL2L1-09        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
P53563_BCL2L1-01        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
A0A2U3V0P1_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
O77737_BCL2L1-01        ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
Q9MYW4_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
F6WQI0_BCL2L1-01        ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
B2Z3Z4_BCL2L1-01        ----V---LV--S--R-----IASWMATYLNDHLEPWIQD-NGGW-----
Q05KJ0_BCL2L1-02        ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
Q05KJ0_BCL2L1-01        ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
E2IV76_BCL2L1-01        ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
A0A2K6G3C5_BCL2L1-      ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
M3Z2H9_BCL2L1-01        ----A---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
A0A0D9RJZ8_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A286Y5D6_BCL2L1-      ----V---LV--R--R-----IASWMATYLNDHLEPWIQD-NGGW-----
A0A1L5BWY3_BCL2L1-      ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
I3MUP5_BCL2L1-03        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
I3MUP5_BCL2L1-01        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
I3MUP5_BCL2L1-02        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
G1P9D2_BCL2L1-01        ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
A0A2K5EBP4_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
E2IV75_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
F7IT34_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
F7IT34_BCL2L1-02        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
Q76LT7_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K5M8B1_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K5H963_BCL2L1-      ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
M3XA94_BCL2L1-01        ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
Q8SQ42_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
G3RY91_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
Q07817_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
Q07817_BCL2L1-03        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K5VPG2_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
F6UKR4_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K5YR37_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2J8VIH3_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K6LPM4_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K6QFA2_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K6QFA2_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A2K6UWY8_BCL2L1-      ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
E2IV77_BCL2L1-01        ----V---LV--S--R-----IAAWMATYLNDHLEPWIQE-NGGW-----
A0A452SDS4_BCL2L1-      ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
A0A384D3U1_BCL2L1-      ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
A0A452FWV3_BCL2L1-      ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
Q9MZS7_BCL2L1-01        ----V---LV--S--R-----IATWMATYLNDHLEPWIQE-NGGW-----
Q64373_BCL2L1-03        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
Q64373_BCL2L1-04        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
P53563_BCL2L1-04        ----V---LV--S--R-----IASWMATYLNDHLEPWIQE-NGGW-----
A0A3B1IEV7_MCL1-01      ----H---CV--E--N-----VAQHISTYLNTHQHQWLIN-NNAW-----
A0A3B4E3I4_MCL1-03      ----Q---CV--E--N-----VIQHISTYLSTDQRQWLIN-NKAW-----
A0A3B4E3I4_MCL1-02      ----Q---CV--E--N-----VIQHISMYLSTDQRQWLIN-NKAW-----
A0A3B4E3I4_MCL1-01      ----Q---CV--E--N-----VIQHISTYLSTDQRQWLIN-NKAW-----
A0A3Q3B0R2_BCL2-01      ----P---QV--D--H-----IAEWMTEYLNGPLNSWIED-NGGW-----
A0A3Q2PN77_BCL2-01      ----S---QV--D--N-----IAEWMTEYLNGPLGSWIQD-NGGW-----
A0A1X9JZA1_BCL2-01      ----A---QV--N--N-----IAEWMTEYLNGPLNSWIQD-NGGW-----
A0A3Q0S5Z7_BCL2-01      ----S---QV--D--N-----IAEWMTEYLNGPLNSWIQD-NGGW-----
A0A3P8QVM8_BCL2-01      ----S---QV--D--N-----IADWMTEYLNGPLNSWIQD-NGGW-----
A0A3P9DIG5_BCL2-01      ----S---QV--D--N-----IADWMTEYLNGPLNSWIQD-NGGW-----
A0A3Q2UYW8_BCL2-01      ----S---QV--D--N-----IADWMTEYLNGPLNSWIQD-NGGW-----
A0A3B4G3K4_BCL2-01      ----S---QV--D--N-----IADWMTEYLNGPLNSWIQD-NGGW-----
A0A3Q1I5N1_BCL2-01      ----P---QV--N--N-----IAEWMTEYLNGPLHSWIQD-NGGW-----
A0A3Q3K1K1_BCL2-01      ----P---QV--D--K-----IAEWMTEYLNGPLNSWIQE-NGGW-----
A0A3Q3MEY1_BCL2-01      ----S---QV--D--N-----IAEWMTEYLNGPLNSWIQD-NGGW-----
A0A3Q1FLK7_BCL2-01      ----S---QV--D--N-----IAEWMTEYLNGPLNSWIQD-NGGW-----
A0A3Q1B8C3_BCL2-01      ----S---QV--D--N-----IAEWMTEYLNGPLNSWIQD-NGGW-----
A0A3P8S9L3_BCL2-01      ----S---QV--D--N-----IAEWMTEYLNGPLNSWIQD-NGGW-----
A0A3B5BBQ0_BCL2-01      ----S---QV--D--N-----IAEWMTEYLNGPLNSWIQD-NGGW-----
A0A3B4TX71_BCL2-01      ----S---QV--D--N-----IVEWMTEYLNGPLNSWIKD-NGGW-----
A0A3B4YAG2_BCL2-01      ----S---QV--D--N-----IVEWMTEYLNGPLNSWIKD-NGGW-----
A0A286XUI2_BCL2A1-      ----PDVDTY--K--E-----ISYFVAEFIMSRMGGWIRQ-NGGW-----
Q564A4_BCL2-01          ----S---QV--D--N-----IAHWMTDYLNGPLENWIEE-NGGW-----
W5N4F7_BCL2-01          ----S---QV--D--N-----IANWMTEYLNGPLQNWIQE-NGGW-----
A0A3Q4MN81_BCL2L10      ----Q---EP-MSCRR-----LAETIADYLGEEKKDWLLD-NDGW-----
A0A3B4ETX9_BCL2L10      ----Q---EP-MSCRR-----LAETIADYLGEEKKDWLLD-NDGW-----
D2IT42_BCL2L10-02       ----Q---VPGGSCRG-----LAETIADYLGEEKRDWLLE-NGGW-----
A0A3Q0S9R1_BCL2L10      ----Q---EP-ISCRE-----LAETIADYLGEEKKDWLLD-NDGW-----
I3J363_BCL2L10-01       ----Q---EP-MSCRR-----LAETIADYLGEEKKDWLLD-NDGW-----
A0A3Q2UUP0_BCL2L10      ----Q---EP-MSCRR-----LAETIADYLGEEKKDWLLD-NDGW-----
A0A3P8PVZ8_BCL2L10      ----Q---EP-MSCRR-----LAETIADYLGEEKKDWLLD-NDGW-----
A0A3Q2UUP0_BCL2L10      ----Q---EP-MSCRR-----LAETIADYLGEEKKDWLLD-NDGW-----
A0A3P9BLI0_BCL2L10      ----Q---EP-MSCRR-----LAETIADYLGEEKKDWLLD-NDGW-----
A0A3Q2PJS5_BCL2L10      --------EP-VSCRE-----LAETIADYLEKHKKDWLQE-NDGW-----
A0A3Q2GL87_BCL2L10      ----T---EP-VSCRA-----LAETIADYLETHKKDWLQE-NNGW-----
A0A3B5MJ12_BCL2L10      ----Q---EP-VSCRA-----LAETIADYLEKHKKDWLQE-NNGW-----
M4AUW7_BCL2L10-01       ----Q---EP-VSCRA-----LAETIADYLEKHKKDWLQE-NNGW-----
A0A096ME02_BCL2L10      ----Q---EP-VSCRA-----LAETIADYLEKHKKDWLQE-NNGW-----
A0A3B3TYN4_BCL2L10      ----Q---EP-VSCRA-----LAETIADYLEKHKKDWLQE-NNGW-----
A0A3B3YT99_BCL2L10      ----Q---EP-VSCRA-----LAETIADYLEKHKKDWLQE-NNGW-----
A0A3P9NE65_BCL2L10      ----Q---ET-VSCRA-----LAETIADYLEKHKKDWLQE-NNGW-----
A0A3P9LM07_BCL2L10      ----P---GP-VSCQA-----LAETVADFLGGDKKEWMLE-NDGW-----
H2MBQ3_BCL2L10-01       ----P---GP-VSCQA-----LAETVADFLGGDKKEWMLE-NDGW-----
A0A3B4AAV4_BCL2L10      ----Q---VP-SDCRR-----LAQTIADYLGEEKRDWLLE-NGGW-----
A0A3Q3EZU5_BCL2L10      ----Q---GP-GHCRG-----LAETIADYLGEEKKEWLLE-NDGW-----
A0A3Q3EZU5_BCL2L10      ----Q---GP-GHCRG-----LAETIADYLGEEKKEWLLE-NDGW-----
A0A3Q3JQ78_BCL2L10      ----Q---GP-GNCRE-----LAETIADYLGEEKKDWLLE-NDGW-----
A0A3B4TIY6_BCL2L10      ------------NCRG-----LAETIADYLGEEKKDWLLE-NGGW-----
A0A3B4WGF4_BCL2L10      ------------NCRG-----LAETIADYLGEEKKDWLLE-NGGW-----
A0A3Q3KZW1_BCL2L10      ----Q---GP-ESCRG-----LAETIADYLGEEKKDWLQE-NDGW-----
A0A3B5KD08_BCL2L10      ----Q---VP-ENCRG-----LAETIADYLGEEKKDWLLE-NGGW-----
A0A3Q3VI28_BCL2L10      ----Q---VP-GNCSE-----LAETIADYLGEEKKAWLLE-NDGW-----
A0A3Q1GM98_BCL2L10      ----Q---RP-VNCRG-----LAETIADYLGEEKKDWLLE-NDGW-----
A0A3Q1D2L0_BCL2L10      ----Q---GP-VNCRE-----LAETIADYLGEEKKDWLLE-NDGW-----
A0A3P8RL82_BCL2L10      ----Q---GP-VNCRE-----LAETIADYLGEEKKDWLLE-NDGW-----
A0A3B4ZFS0_BCL2L10      ----Q---GP-VNCRG-----LAETIADYLGEEKKDWLLE-NDGW-----
A0A3B4AFB7_MCL1-01      ----S---CV--E--R-----VGQEISSYLLLDQRDWLVR-NNAW-----
B9ZYL7_BCL2-01          ----P---LV--D--S-----IVGWMTEYLNRHLQNWIQE-Q--------
A0A452I9V7_BCL2-01      ----P---LV--D--S-----IAVWMTEYLNRHLHNWIQD-NGGW-----
H9GPE7_BCL2-01          ----P---LV--D--N-----IATWMTEYLNQYLRNWIQE-NGGW-----
A0A3Q2HRY3_BCL2-02      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
K7F5Y4_BCL2-02          ----P---LV--D--S-----IAVWMTEYLNRHLHNWIQD-NGGW-----
K7F5Y4_BCL2-01          ----P---LV--D--S-----IAVWMTEYLNRHLHNWIQD-NGGW-----
F6YNL8_BCL2-01          ----P---LV--D--S-----IALWMTEYLNRHLHTWIQD-NGGW-----
H0YUX3_BCL2-01          ----P---LV--D--N-----IATWMTEYLNRHLHNWIQD-NGGW-----
H0W1T3_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
J9NXG3_BCL2-02          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
G1LID1_BCL2-02          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
I3MVK9_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
G1TW27_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
P10417_BCL2-02          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A096MPU7_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
P10417_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
Q7TSN8_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
Q6R755_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
Q9JJV8_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
Q923R6_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
F1LNV0_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
P49950_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
H2NWH5_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A3Q2HRY3_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K6G3I7_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A287APJ6_BCL2-03      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
H0WKI0_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K5UDI5_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K5EB04_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2R8MY14_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
Q568V1_MCL1-01          ----Q---CV--E--R-----VAEQISSYLTSEQQDWILK-NKSC-----
Q1L8X3_MCL1-01          ----Q---CV--E--R-----VAEQISSYLTSEQQDWILK-NKSW-----
Q9I9N3_MCL1-01          ----Q---CV--E--R-----VAEQISSYLTSEQQDWILK-NKSW-----
A0A3B3ICL7_BCL2L1-      ----E---LV--S--R-----IAEWMTQYLDEQISPWIHS-HGGW-----
A0A3B3E2W4_BCL2L1-      ----E---LV--S--R-----IAEWMTMYLDEQISPWIHS-QGGW-----
A0A3B5B4X7_BCL2L1-      ----E---LV--P--R-----IADWMTMYLDEHISLWIQS-QGGW-----
A0A3B4BFZ8_BCL2L1-      ----I---LV--P--R-----IANWMTIYLDENIATWIQN-QGGW-----
A0A3Q3FUB6_BCL2L1-      ----E---LV--S--R-----IAGWMTTYLDEHISAWIES-QGGW-----
A0A3B5MGS2_BCL2L1-      ----E---LV--S--R-----IAEWMTTYLDEQLSPWIQS-QGGW-----
M4A558_BCL2L1-01        ----E---LV--S--R-----IAEWMTTYLDEQLSPWIQS-QGGW-----
A0A3P9QFB3_BCL2L1-      ----E---LV--S--R-----IAEWMTTYLDEQLNPWIQS-QGGW-----
A0A087YBW4_BCL2L1-      ----E---LV--S--R-----IAEWMTTYLDEQLNPWIQS-QGGW-----
A0A3B3VWI7_BCL2L1-      ----E---LV--S--R-----IAEWMTTYLDEQLNPWIQS-QGGW-----
A0A3B3XN57_BCL2L1-      ----E---LV--S--R-----IAEWMTTYLDEQLNPWIQS-QGGW-----
A0A3Q2C6K4_BCL2L1-      ----E---LV--S--R-----IADWMTIYLDEQLNPWIHS-QGGW-----
A0A3Q2NRP4_BCL2L1-      ----E---LV--P--R-----IADWMTIYLDEQLDPWVRS-QGGW-----
A0A0B4KJI5_BCL2L1-      ----E---LV--S--R-----IADWMTMYLDEHINPWIES-QGGW-----
A0A3Q1JZ46_BCL2L1-      ----E---LV--S--R-----IADWMTMYLDEHISPWIQS-QGGW-----
A0A3Q1JZ46_BCL2L1-      ----E---LV--S--R-----IADWMTMYLDEHISPWIQS-QGGW-----
A0A3Q3NFM4_BCL2L1-      ----A---LV--S--R-----IADWMTMYLDEHISPWIES-QGGW-----
A0A3Q3NFM4_BCL2L1-      ----A---LV--S--R-----IADWMTMYLDEHISPWIES-QGGW-----
A0A3B4V9K8_BCL2L1-      ----E---LV--S--R-----ITDWMTMYLDEHISPWIQS-QGGW-----
A0A3B4XS24_BCL2L1-      ----E---LV--S--R-----IADWMTMYLDEHISPWIQS-QGGW-----
C1BLI0_BCL2L1-01        ----H---LV--A--R-----IADWMTTYLDNHIQPWIQR-QGGW-----
C0HAD8_BCL2L1-01        ----P---LV--A--R-----IADWMTTYLDNHIQPWIQS-QGGW-----
A0A3B3ZN55_BCL2L1-      ----T---LV--A--R-----IVTWMTVYLDEHIQDWIDS-QGGW-----
A0A3B5K6B9_BCL2L1-      ----P---LV--G--R-----IIEWMTVYLDNHIQPWIQS-QGGW-----
A0A3B5K6B9_BCL2L1-      ----P---LV--G--R-----IIEWMTVYLDNHIQPWIQS-QGGW-----
H3CH49_BCL2L1-01        ----P---LV--G--R-----IIEWMTVYLDNHIQPWIQS-QGGW-----
A0A3B3TFR4_BCL2L1-      ----P---LV--G--H-----IVDWMTVYLDNHIQPWIQT-QGGW-----
A0A3Q2FR43_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDEQIDPWIQS-QGGW-----
A0A3P8XYL5_BCL2L1-      ----P---LV--G--R-----IADWMTVYLDNHIQPWIES-QGGW-----
Q90Z98_BCL2L1-02        ----P---LV--G--R-----IAEWMTVYLDNHIQPWIQS-QGGW-----
Q90Z98_BCL2L1-01        ----P---LV--G--R-----IAEWMTVYLDNHIQPWIQS-QGGW-----
A0A059PJI5_BCL2L1-      ----P---LV--A--R-----IAEWMTVYLDNHIQPWIEE-QGGW-----
A0A3B4DTL9_BCL2L1-      ----P---LV--G--R-----IAEWMTVYLDNHIQPWIQE-QGGW-----
B5XAY3_BCL2L1-01        ----P---LV--G--R-----ITDWMTVYLDNHIQPWIQS-QGGW-----
W5MG74_BCL2L1-01        ----N---LV--S--R-----IAEWMTVYLDNNIQPWIQS-QGGW-----
A0A3Q3B3X5_BCL2L1-      ----H---LV--A--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3B3IB64_BCL2L1-      ----P---LV--D--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3P9JYH1_BCL2L1-      ----P---LV--D--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3B3DHA1_BCL2L1-      ----P---LV--D--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3Q0RTF8_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
I3IZK7_BCL2L1-01        ----P---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A2U9BY16_BCL2L1-      ----S---LV--G--R-----IVEWMTVYLDNNIQPWIQS-QGGW-----
A0A0D6DR75_BCL2L1-      ----Q---LV--V--R-----IVEWMTVYLDDHIQPWIQS-QGGW-----
A0A3Q3WIW8_BCL2L1-      ----P---LV--G--R-----IIEWMTVYLDNQIQPWIES-QGGW-----
A0A219P0Y3_BCL2L1-      ----P---LV--G--R-----IIEWKTRYLDNHIQPWIQS-QRGW-----
A0A3Q3MX20_BCL2L1-      ----P---LV--G--R-----IVEWMTLYLDNHIEPWIQS-QGGW-----
A0A3Q3G2E1_BCL2L1-      ----P---LV--G--R-----IIEWMTVYLDNRIQPWIES-QGGW-----
A0A3Q3G2E1_BCL2L1-      ----P---LV--G--R-----IIEWMTVYLDNRIQPWIES-QGGW-----
A0A3Q3G2E1_BCL2L1-      ----P---LV--G--R-----IIEWMTVYLDNRIQPWIES-QGGW-----
A0A3Q1GZ93_BCL2L1-      ----Q---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3Q1GZ93_BCL2L1-      ----Q---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3Q1GZ93_BCL2L1-      ----Q---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3B4V3T1_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNRIQPWIQS-QGGW-----
A0A3B4XU17_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNRIQPWIQS-QGGW-----
A0A3B3QRZ2_BCL2L1-      ----H---LV--D--R-----IADWMTVYLDSNIQPWIQR-QGGW-----
A0A3B3ZN55_BCL2L1-      ----T---LV--A--R-----IVTWMTVYLDEHIQDWIDS-QGGW-----
G3NJY1_BCL2L1-01        ----P---LV--G--R-----IVEWMTLYLDNHIQPWIQN-QGGW-----
A0A3Q3DUT7_BCL2L1-      ----P---LV--D--R-----IIEWMTVYLDNHLQPWIES-QGGW-----
A0A3Q3DUT7_BCL2L1-      ----P---LV--D--R-----IIEWMTVYLDNHLQPWIES-QGGW-----
A0A3Q3DUT7_BCL2L1-      ----P---LV--D--R-----IIEWMTVYLDNHLQPWIES-QGGW-----
A0A3B1JJ42_BCL2L1-      ----P---LV--G--R-----IAEWMTVYLDNHIQPWIQE-QGGW-----
A0A3P8UWG7_BCL2L1-      ----Q---LV--A--R-----IADWMTVYLDNHIQPWIET-QGGW-----
A0A3Q3IVF5_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQPWIQG-QGGW-----
A0A3Q1DHJ3_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQDWIQS-QGGW-----
A0A3Q1DHJ3_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQDWIQS-QGGW-----
A0A3Q1DHJ3_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQDWIQS-QGGW-----
A0A3P8TL99_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQDWIQS-QGGW-----
A0A3P8TL99_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQDWIQS-QGGW-----
A0A3Q1GS47_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQDWIQG-QGGW-----
A0A3B4Z3X2_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQDWIQS-QGGW-----
A0A3B4Z3X2_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQDWIQS-QGGW-----
C3VIT1_BCL2L1-01        ----P---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3P8P0F1_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3Q2X557_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3P9D632_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3P9D632_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3Q4N4B5_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3B4FNX1_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDNHIQPWIQS-QGGW-----
A0A3Q2QPL9_BCL2L1-      ----P---LV--G--R-----IVEWMTVYLDEQIDPWIQS-QGGW-----
A0A3B5PQJ0_BCL2L1-      ----H---LV--A--R-----IVEWMTVYLDEQIEPWVES-QGGW-----
A0A087X9B7_BCL2L1-      ----H---LV--A--R-----IVEWMTVYLDERIEPWVES-QGGW-----
A0A3B3TUS7_BCL2L1-      ----H---LV--A--R-----IVEWMTVYLDERIEPWVES-QGGW-----
A0A3B3WI27_BCL2L1-      ----H---LV--A--R-----IVEWMTVYLDERIEPWVES-QGGW-----
A0A3P9N9Y4_BCL2L1-      ----H---LV--A--R-----IVEWMTVYLDERIEPWVES-QGGW-----
A0A3Q3BEB7_BCL2L1-      ----E---LV--S--R-----IADWMTVYLDEQIGPWIDS-QGGW-----
A0A3P8VMA1_BCL2L1-      ----E---LV--P--R-----IADWMTMYLDEYIDPWIQS-QGGW-----
A0A345BSW9_BCL2L1-      ----P---LV--G--R-----IAEWMTVYLDNHIQPWIQS-QGGW-----
A0A286MU87_BCL2L1-      ----P---LV--A--R-----IADWMTTYLDNHIQPWIQS-QGGW-----
A0A3P8XFS0_BCL2L1-      ----L---LV--A--R-----IADWMTTYLDEHIQPWIQI-QGGW-----
A0A3P8XFS0_BCL2L1-      ----L---LV--A--R-----IADWMTTYLDEHIQPWIQI-QGGW-----
A0A0F7L1T6_BCL2L1-      ----Q---LV--C--R-----IADWMTIYLDEHINPWIQS-QGGW-----
H2U5I3_BCL2L1-01        ----Q---LV--C--R-----IADWMTIYLDEHINPWIQS-QGGW-----
H2U5I3_BCL2L1-02        ----Q---LV--C--R-----IADWMTIYLDEHINPWIQS-QGGW-----
A0A3Q3J5K3_BCL2L1-      ----E---LV--S--R-----IADWMTMYLDEHISPWIQN-QGGW-----
A0A3Q1EVP6_BCL2L1-      ----E---LV--P--R-----IADWMTMYLDEHISPWIQS-QGDW-----
A0A3Q1BQA0_BCL2L1-      ----E---LV--P--R-----IADWMTMYLDEHISPWIQS-QGGW-----
A0A3P8U812_BCL2L1-      ----E---LV--P--R-----IADWMTMYLDEHISPWIQS-QGGW-----
E6ZFR0_BCL2L1-01        ----E---LV--S--R-----IADWMTMYLDEHISPWIQS-QGGW-----
G3P7B4_BCL2L1-01        ----E---LV--S--R-----IADWMTTYLDEHISAWIQS-QGGW-----
A0A3Q3X5M5_BCL2L1-      ----E---LV--C--R-----IADWMTTYLDEHINPWIQS-QGGW-----
A0A2U9BIG9_BCL2L1-      ----E---LV--A--R-----IADWMTMYLDEHISPWIQS-QGGW-----
A0A3B3C5I4_BCL2L10      ----PGPVSC--Q--A-----LAETVADFLGGDKKEWMLE-NDGW-----
A0A3Q2Y539_MCL1-01      ----RCVELVAQE------------VSTYLLSHQRTWLVQ-HNGW-----
H3AR18_MCL1-02          ----D---SI--E--Q-----LAVSITDFLVQNKGDWILK-NQGW-----
A0A3B1K5R1_MCL1-01      ----HCVSLVGEE------------LSSYLLSDERDWLLK-NKAW-----
A0A3B4C6H5_MCL1-01      ----HCVSLVGQE------------ISSYLLSDQKDWLLK-NKAW-----
A0A3B4C6H5_MCL1-02      ----HCVSLVGQE------------ISSYLLSDQKDWLLK-NKAW-----
A0A3B4C6H5_MCL1-03      ----HCVSLVGQE------------ISSYLLSDQKDWLLK-NKAW-----
A0A3Q1IAB0_BCL2L10      ----QEPGQC--R--G-----LAETIADYLGEEKKDWLLE-NDGW-----
Q5XGJ4_BCL2L2-01        ----P---LL--P--R-----IQDWMVTYLETNLRDWIQS-NGGW-----
A0A3P8WUE9_BCL2-01      ----P---QV--E--Q-----VVDWMTEYLNGPLNIWIKE-NGGW-----
A0A3Q3G1D7_BCL2-01      ----S---QV--D--N-----IAEWMTEYLNGPLNSWIQD-NGGW-----
A0A3B4A3G8_BCL2-01      ----S---QV--D--N-----IADWMTEYLNGTLSSWIQD-NGGW-----
D2ITA2_BCL2L1-02        ----H---MV--P--R-----VAEWMTRYLDDHIDHWIQS-NGGW-----
A0A452FIG6_BCL2L1-      ----V---LV--S--Q-----VMTWMASQLNDHLEPWIQE-NGGW-----
A0A452FIG6_BCL2L1-      ----V---LV--S--Q-----VMTWMASQLNDHLEPWIQE-NGGW-----
Q8UWD6_MCL1-01          ----KYVRLVGEE------------ISSYLLTEQRDWILR-NKAW-----
F8W4Q8_MCL1-01          ----KYVRLVGEE------------ISSYLLTEQRDWILR-NKAW-----
Q568W5_MCL1-01          ----KYVRLVGEE------------ISSYLLTEQRDWILR-NKAW-----
M3Y8D1_BCL2L10-01       ----EWEASVRQDCRR-----LVDFLCGRLTGQHRAWLEA-HGGW-----
H3ANS8_BCL2L1-01        ----S---LV--E--R-----IAEWMTTYLDDNLNPWIQE-QGGW-----
F7G6M3_BCL2L2-01        ----P---LV--G--Q-----VQDWMVAYLDTQLADWIRS-SGGW-----
G1TV33_BCL2L2-01        ----P---LV--G--Q-----VQEWMVTYLETQLAGWIHS-TGGW-----
A0A2K5CWZ4_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2R8M4C0_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
G3TMU7_BCL2L2-01        ----P---LV--G--Q-----VQEWMVVYLETRLADWIHS-SGGW-----
A0A2K5CWZ4_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A2K6TM77_BCL2L2-      ----P---LV--G--Q-----VQEWMVAYLETRLADWIHS-SGGW-----
A0A3P8W7K5_BCL2L10      ----PEPGTC--R--E-----LAETIADYLGEEKKAWLLE-NGGW-----
A0A3B3ICL7_BCL2L1-      ----E---LV--S--R-----IAEWMTQYLDEQISPWIHS-HGGW-----
A0A452U2H8_BCL2A1-      ----P---DV--DASR-----ISYFVAEFITTNMREWIRQ-NGGW-----
A0A452U2H8_BCL2A1-      ----P---DV--DASR-----ISYFVAEFITTNMREWIRQ-NGGW-----
F7BXJ7_BCL2-01          ----P---LV--D--S-----IVGWMTEYLNSHLQNWIQE-QGGW-----
A0A3B3TCS4_BCL2-01      ----S---QV--D--N-----IAHWMTEYLNGPLHNWIQE-NGGW-----
H0Z8G3_BCL2L1-01        ----V---LV--K--R-----IVSWMTTYLTDHLDPWIQE-NGGW-----
U3JSL7_BCL2L1-01        ----V---LV--K--R-----IVSWMTTYLTDHLDPWIQE-NGGW-----
Q4U2V6_BCL2L1-01        ----V---LV--K--R-----IVSWMTTYLTDHLDPWIQE-NGGW-----
A0A3P8YNB4_BCL2-01      ----S---QV--D--H-----IAGWMTEYLNGPLHSWIQE-NGGW-----
A0A3P9AAB2_BCL2-01      ----P---QV--N--N-----IVHWMTEYLNGPLQNWIQE-NGGW-----
A0A0U3DHY6_BCL2-01      ----S---QV--D--N-----IALWMTEYLNGPLQNWIQE-NGGW-----
X4ZGI8_BCL2-01          ----S---QV--D--N-----IAHWMTDYLNGPLENWIEE-NGGW-----
U3KEW4_BCL2-01          ----P---LV--D--S-----IAAWMTEYLNRHLHNWIQD-NGGW-----
Q00709_BCL2-01          ----P---LV--D--N-----IATWMTEYLNRHLHNWIQD-NGGW-----
K7F5Y4_BCL2-03          ----P---LV--D--S-----IAVWMTEYLNRHLHNWIQD-NGGW-----
G3WZW9_BCL2-01          ----P---LV--D--S-----IALWMTEYLNRHLHNWIQD-NGGW-----
A0A452R145_BCL2-02      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
M3YYK3_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
P10415_BCL2-04          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K6R2I6_BCL2-02      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
J9NXG3_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A1D5QRF2_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2R9APW6_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
G3ULB7_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A9QXG9_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K5NZS5_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A0D9S017_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K6CIX3_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K5XRD4_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K6KHG1_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K6R2I6_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K5HK49_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
G3QES9_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2I3GZF9_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2K6UEL3_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
P10415_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
P10415_BCL2-02          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
H2QEM8_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A2U4BHU7_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
Q75SV7_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
M3X1R9_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A076FU27_BCL2-01      ----P---LV--D--S-----IALWMTEYLNRHLHAWIQD-NGGW-----
F6R2C4_BCL2-01          ----P---LV--D--S-----IALWMTEYLNRHLHTWIQD-NGGW-----
O02718_BCL2-01          ----P---LV--D--S-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A076FZV9_BCL2-01      ----P---LV--D--S-----IALWMTEYLNRHLHAWIQD-NGGW-----
A0A452EV13_BCL2-01      ----P---LV--D--S-----IALWMTEYLNRHLHAWIQD-NGGW-----
G1LID1_BCL2-01          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A452R145_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
G3WZW9_BCL2-02          ----P---LV--D--S-----IALWMTEYLNRHLHNWIQD-NGGW-----
G3ULB7_BCL2-02          ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
A0A452T603_BCL2-01      ----P---LV--D--N-----IALWMTEYLNRHLHTWIQD-NGGW-----
G3PJT0_MCL1-01          ----N---CV--E--L-----VGQEISAYLLSDQRDWLIK-NNAW-----
A0A3Q3VP02_MCL1-01      ----D---RV--E--L-----VAHEISTYLLTDQRDWMCV---GG-----
A0A3B5K5B3_MCL1-01      ----D---CV--E--P-----VAQEISTYLLTDRRDWLIK-NNGW-----
H2MLZ3_MCL1-01          ----H---CV--D--L-----VSQEICTYLLSEQRNWLVN-NNSW-----
H2MLZ3_MCL1-02          ----H---CV--D--L-----VSQEICTYLLSEQRNWLVN-NNSW-----
A0A3B3CEX1_MCL1-02      ----H---SV--D--L-----VSQEICTYLLREQRDWLIN-NNSW-----
A0A3B3CEX1_MCL1-01      ----H---SV--D--L-----VSQEICTYLLREQRDWLIN-NNSW-----
A0A3Q3B4V7_MCL1-01      ----E---CV--E--L-----VGQEISTYLLSEQKDWLLK-NNSW-----
A0A3Q3B4V7_MCL1-02      ----E---CV--E--L-----VGQEISTYLLSEQKDWLLK-NNSW-----
A0A3Q2EDX8_MCL1-01      ----N---CV--E--L-----VSQEISTYLLQNQRDWLVK-NNSW-----
A0A3Q2T2A9_MCL1-02      ----H---CV--D--L-----VSREISTYLLTNQRDWLAK-NNSW-----
A0A3Q2T2A9_MCL1-01      ----H---CV--D--L-----VSREISTYLLTNQRDWLAK-NNSW-----
A0A3B5PQ55_MCL1-02      ----H---CV--E--L-----VSRKISTYLLANQRDWLAK-NNSW-----
A0A3B5PQ55_MCL1-01      ----H---CV--E--L-----VSRKISTYLLANQRDWLAK-NNSW-----
A0A3P9Q4R7_MCL1-02      ----H---CV--D--L-----VSQEISTYLLAKQRDWLAK-NNSW-----
A0A3P9Q4R7_MCL1-01      ----H---CV--D--L-----VSQEISTYLLAKQRDWLAK-NNSW-----
A0A087X830_MCL1-01      ----H---CV--E--L-----VSKEISTYLLENQRDWLAK-NNSW-----
A0A3B3YCD0_MCL1-01      ----H---CV--E--L-----VSKEISTYLLENQRDWLAK-NNSW-----
A0A3P8VKS9_MCL1-02      ----N---ST--E--L-----VGREISSYLLSYQRDWLLK-NNSW-----
A0A3P8VKS9_MCL1-01      ----N---ST--E--L-----VGREISSYLLSYQRDWLLK-NNSW-----
A0A3P8VKS9_MCL1-05      ----N---ST--E--L-----VGREISSYLLSYQRDWLLK-NNSW-----
A0A3P8VKS9_MCL1-04      ----N---ST--E--L-----VGREISSYLLSYQRDWLLK-NNSW-----
A0A3P8VKS9_MCL1-03      ----N---ST--E--L-----VGREISSYLLSYQRDWLLK-NNSW-----
I3JHR5_MCL1-01          ----N---CV--A--L-----VSQEVSAYLLSEQRDWIVK-NNAW-----
A0A3Q4HLQ8_MCL1-01      ----N---CV--A--L-----VSQEISAYLLSEQRDWIVK-NNAW-----
A0A3P8NP63_MCL1-02      ----N---YV--A--L-----VSQEISAYLLSEQRDWIVK-NNAW-----
A0A3P8NP63_MCL1-03      ----N---YV--A--L-----VSQEISAYLLSEQRDWIVK-NNAW-----
A0A3Q2VNL8_MCL1-01      ----N---YV--A--L-----VSQEISAYLLSEQRDWIVK-NNAW-----
A0A3P8NP63_MCL1-01      ----N---YV--A--L-----VSQEISAYLLSEQRDWIVK-NNAW-----
A0A3P9BVM3_MCL1-01      ----N---YV--A--L-----VSQEISAYLLSEQRDWIVK-NNAW-----
A0A3B4G4Z6_MCL1-01      ----N---YV--A--L-----VSQEISAYLLSEQRDWIVK-NNAW-----
A0A2U9CJ81_MCL1-01      ----N---CV--E--L-----VGQEISTYLLTDQRDWLVK-NNSW-----
A0A3Q3IZW0_MCL1-01      ----N---CV--E--L-----VGQEISTYLLSHQRDWLVK-NNAW-----
A0A3Q1GX28_MCL1-02      ----N---CV--D--L-----VAQEISSYLLSAQRDWLVR-NNSW-----
A0A3Q1GX28_MCL1-01      ----N---CV--D--L-----VAQEISSYLLSAQRDWLVR-NNSW-----
A0A3B4XKA5_MCL1-01      ----N---CV--E--S-----VGQEISKYLLSDQRDWLVK-NNSW-----
A0A3Q3GP42_MCL1-01      ----H---CV--E--L-----VGQEISTYLLSDHRDWLVK-NNAW-----
A0A3Q3M6G2_MCL1-02      ----D---CV--E--L-----VGQEISTYLLSDQRDWLVK-NNSW-----
A0A3Q3M6G2_MCL1-01      ----D---CV--E--L-----VGQEISTYLLSDQRDWLVK-NNSW-----
W5MMB7_MCL1-01          ----S---CV--E--A-----VGQAISNYLLQDQREWLLN-NRGW-----
A0A3B3R4U0_MCL1-01      ----N---CV--D--D-----VASRISCYLLEHQRDWLNR-NNGW-----
A0A3B3SG34_MCL1-01      ----H---CV--E--A-----VGKQISSYLLSEQRQWLLK-NKAW-----
Q4SW32_MCL1-01          ----D---CV--E--Q-----VAQEISTYLLTDQRDWLIK-NNAW-----
D2ITA0_MCL1-03          ----G---CV--S--L-----VAEEISSYLLSDQREWLVK-NNSW-----
D2ITA0_MCL1-04          ----G---CV--S--L-----VAEEISSYLLSDQREWLVK-NNSW-----
Q0KFR9_MCL1-01          ----H---CV--E--L-----VGQEIAKYLLSDQSDWLIK-NNAW-----
A0A3P8Y1W8_MCL1-01      ----N---CV--E--L-----VGQEISTYLLTDQRAWLVK-NNAW-----
A0A3P8Y1W8_MCL1-02      ----N---CV--E--L-----VGQEISTYLLTDQRAWLVK-NNAW-----
A0A3Q2XZL8_MCL1-01      ----H---CV--E--P-----VADEISSYLLSHQRNWLVK-NNSW-----
A0A3B4AFB7_MCL1-02      ----S---CV--E--R-----VGQEISSYLLLDQRDWLVR-NNAW-----
A0A3B3VM25_MCL1-01      ----H---CV--E--L-----VIQEISTYLLENQRDWLAK-NNSW-----
A0A3Q0RA11_MCL1-03      ----N---CV--E--L-----VSQEISTYLLSDQRDWLVK-NNAW-----
A0A3Q0RA11_MCL1-01      ----N---CV--E--L-----VSQEISTYLLSDQRDWLVK-NNAW-----
A0A3B4T8L9_MCL1-02      ----N---CV--E--S-----VGQEISKYLLSDQRDWLVK-NNSW-----
A0A3B4T8L9_MCL1-01      ----N---CV--E--S-----VGQEISKYLLSDQRDWLVK-NNSW-----
A0A3Q1EQB9_MCL1-02      ----N---CV--D--L-----VSQEISTYLLSEQRDWLVK-NNSW-----
A0A3B4ZKP6_MCL1-01      ----N---CV--D--L-----VSEEISTYLLCDQRDWLVK-NNSW-----
A0A3Q1BKL8_MCL1-02      ----N---CV--D--L-----VSQEISTYLLSEQRDWLVK-NNSW-----
A0A3Q1EQB9_MCL1-01      ----N---CV--D--L-----VSQEISTYLLSEQRDWLVK-NNSW-----
A0A3Q1BKL8_MCL1-01      ----N---CV--D--L-----VSQEISTYLLSEQRDWLVK-NNSW-----
A0A3P8RQX7_MCL1-02      ----N---CV--D--L-----VSQEISTYLLSEQRDWLVK-NNSW-----
A0A3P8RQX7_MCL1-01      ----N---CV--D--L-----VSQEISTYLLSEQRDWLVK-NNSW-----
U3JTB2_BCL2A1-01        ----Q---LTAEEKEE-----ISYFITEYIINNKSEWIDA-NGGW-----
H0ZCL9_BCL2A1-01        ----Q---LTAEEKEQ-----ISYFITEYIINNKAEWIDA-NGGW-----
Q9W6F2_BCL2A1-01        ----Q---LTGEEKEK-----ISYFITEYIINNKAAWIDA-NGGW-----
G1N8C5_BCL2A1-01        ----Q---LTGEEKEQ-----ISYFITEYIINNKAAWIDA-NGGW-----
A0A452J3N6_BCL2A1-      ----Q---LTGENKKQ-----ISYFITEYIINTKAEWIEA-NGGW-----
K7G130_BCL2A1-01        ----Q---LTGDNKEQ-----ISYFITEYIINTKAEWIDA-NGGW-----
F6SFL4_BCL2A1-01        ----P---LTMGTQEE-----ISHFIAEFIMNNIAEWIRQ-NGGW-----
G3WSP8_BCL2A1-01        ----P---LTMDTHEE-----ISHFIAEFIMNNIAEWIRQ-NGGW-----
F6S8G3_BCL2A1-01        ----P---LTRETREE-----ISCFIAEFTTHHAGEWIRQ-NGGW-----
G1T1L8_BCL2A1-01        ----V---PDVDTFKS-----IPYFVAEFITRRMGEWIRQ-NGGW-----
O55178_BCL2A1-01        ----C---PGCTCLQT-----SFQF-------------------------
Q0P538_BCL2A1-01        ----C---PGCTCLQT-----SFQF-------------------------
A0A337STN9_BCL2A1-      ----V---PDADAFK------VSYFVAEFITKHTGEWIRQ-NGGW-----
A0A337STN9_BCL2A1-      ----V---PDADAFK------VSYFVAEFITKHTGEWIRQ-NGGW-----
E2RS00_BCL2A1-01        ----S---SDVDAEK------VSYFVAEFITRNMRDWIRQ-NGGW-----
M3YVH4_BCL2A1-01        ----S---PDVDASR------VSYFVAEFITTNMREWIRQ-NGGW-----
A0A452SIR9_BCL2A1-      ----S---PDVDASR------ISYFVAEFITTNMREWIRQ-NGGW-----
G3V977_BCL2A1-01        ----A---LDVDTYKQ-----VSSFVAEFIMNNTGEWIQQ-NGGW-----
Q925A9_BCL2A1-01        ----G---LDVDTYKQ-----VSSFVAEFIMNNTGEWIQQ-NGGW-----
Q07440_BCL2A1-01        ----A---LDVCAYKQ-----VSSFVAEFIMNNTGEWIRQ-NGGW-----
O55179_BCL2A1-01        ----A---LDVGAYKQ-----VSSFVAEFIMNNTGEWIRR-NGGW-----
O55177_BCL2A1-02        ----A---LDVGAYKQ-----VSSFVAEFIINNTGEWIRR-NGGW-----
Q497M6_BCL2A1-01        ----A---LDVGAYKQ-----VSSFVAEFIINNTGEWIRR-NGGW-----
Q8K164_BCL2A1-01        ----A---LDVGAYKQ-----VSSFVAEFIINNTGEWIRR-NGGW-----
Q4FK02_BCL2A1-01        ----A---LDVGAYKQ-----VSSFVAEFIINNTGEWIRR-NGGW-----
I3MCZ7_BCL2A1-01        ----A---PAVDSDEE-----ISYFVAEFIMNNAGEWIRQ-NGGW-----
G3T8E6_BCL2A1-01        ----A---PDVDTYKK-----ISSFVAEFIVDNTAEWIRQ-NGGW-----
H0WZ23_BCL2A1-01        ----A---LDVDTYKE-----ISYFVAEFIMNYTGEWIRQ-NGGW-----
A0A2K6TLM0_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRR-NGGW-----
A0A2K5D2I1_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWISQ-NGGW-----
U3DBA0_BCL2A1-02        ----A---PDVDTYKE-----ISHFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6TLM0_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRR-NGGW-----
B4E1X9_BCL2A1-01        ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
Q16548_BCL2A1-02        ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2I2YML2_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2R8ZJX9_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2I3T6T8_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2I3HNF3_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6PHG5_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6LV22_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
F7E8V5_BCL2A1-02        ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K5KHH9_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6AD55_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K5TMD8_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K5KAB6_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6DS80_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A096NMX5_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6EKG1_BCL2A1-      ----A---LDVDTYKE-----ISYFIAEFITNNAGEWIRQ-NGGW-----
Q3C2I0_BCL2A1-01        ----A---SDMDMCKD-----ISFFVAEFITENTGEWIKQ-NGGW-----
A0A452EK63_BCL2A1-      ----A---SDMDMCKD-----ISYFVAEFITENTGEWIRQ-NGGW-----
W5Q0N6_BCL2A1-01        ----A---SDMDMCKD-----ISYFVAEFITKNTGEWIRQ-NGGW-----
F7CP56_BCL2A1-01        ----A---PDVDTYKE-----ISYFVAEFITKNTGEWIRQ-NGGW-----
C7F841_BCL2A1-02        ----A---PDVDTYKE-----ISYFVAEFITKNTGQWIRQ-NGGW-----
C7F841_BCL2A1-01        ----A---PDVDTYKE-----ISYFVAEFITKNTGQWIRQ-NGGW-----
A0A2I3HNF3_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2I2YML2_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2R8ZJX9_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2I3T6T8_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
H2NNZ9_BCL2A1-01        ----A---PDVDTYKE-----ISYFVAEFVMNNTGGWIKQ-NGGW-----
Q16548_BCL2A1-01        ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2I2YML2_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6LV22_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6PHG5_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2R8ZJX9_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2I3T6T8_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2I3HNF3_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K5KHH9_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K5KHH9_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K5KAB6_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K5TMD8_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
F7E8V5_BCL2A1-01        ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6DS80_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6AD55_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A096NMX5_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRQ-NGGW-----
A0A0D9RRC3_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFITNNTGEWIRQ-NGGW-----
A0A2K5D2I1_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWISQ-NGGW-----
U3DBA0_BCL2A1-01        ----A---PDVDTYKE-----ISHFVAEFIMNNTGEWIRQ-NGGW-----
A0A2K6TLM0_BCL2A1-      ----A---PDVDTYKE-----ISYFVAEFIMNNTGEWIRR-NGGW-----
R4JQR8_BCL2L1-01        ----G---MPQLVDSI-----VDWVSTYLCN-SLEQWITD-NGGW-----
A0A346RRN1_BCL2L1-      ----G---MPQLVDSI-----VDWVSVYLCD-NLEPWITS-NGGW-----
Q99M66_BCL2L10-01       ----NRLLLERDCYLI-----VSLLYNRLTG-RHRSWLEA-HGGW-----
F6ZPD4_BCL2L10-01       ----G---VDRD-----------WLRAWWTSCAHGSRGGT-APGW-----
Q9Z0F3_BCL2L10-01       ----NRVIVTRDCCLI-----VNFLYNLLMGRRHRARLEA-LGGW-----
E1B9B3_BCL2L10-01       ----G---VSRDCRLL-----VALLCAQFCE-RHRAWLMT-NGGW-----
F1RZB9_BCL2L10-01       ----N---VSRDCRLL-----VALLCAQLSG-QHRTWLLA-NGGW-----
G1T264_BCL2L10-01       ----E---IARDCQRL-----VALLCARLAG-QHRAWLQA-QGGW-----
F1MV39_BCL2L10-01       ----G---VSRDCRLL-----VALLCAQFCE-RHRAWLMA-NGGW-----
W5QIG4_BCL2L10-01       ----S---VSRDCRLL-----VALLCAQFCE-RHRAWLMA-NGGW-----
A0A2K6F2Q2_BCL2L10      ----E---VARDRQRL-----VALLCARLAG-QHRAWLQA-QGGW-----
H0WZ06_BCL2L10-01       ----E---VARDCQRL-----VALLSSRLVG-QHRVWLEA-QGGW-----
A0A2K6TIT7_BCL2L10      ----D---VARDCQRL-----VGLLSSRLVG-QHRAWLEA-QGGW-----
A0A2K5F974_BCL2L10      ----D---VARDCQRL-----VALLSSRLVG-QHRAWLEA-QGGW-----
F7CT87_BCL2L10-01       ----D---VARDCQRL-----VALLSSRLVG-QHRAWLEA-QGGW-----
A0A0D9RG38_BCL2L10      ----D---VARDCQRL-----VALLSSRLAG-QHRAWLQA-QGGW-----
A0A096NM44_BCL2L10      ----D---VARDCQRL-----VALLSSRLAG-QHRAWLQA-QGGW-----
A0A2K6R5T5_BCL2L10      ----E---VARDCQRL-----VALLSSRLTG-QHRAWLQA-QGGW-----
Q9HD36_BCL2L10-02       ----D---VARDCQRL-----VALLSSRLMG-QHRAWLQA-QGGW-----
G1R3W6_BCL2L10-01       ----D---VARDCQRL-----VALLSSRLVG-QHRAWLQA-QGGW-----
A0A2K5K3B0_BCL2L10      ----D---VARDCQRL-----VALLSSRLAG-QHRAWLQA-QGGW-----
A0A2K6M5H5_BCL2L10      ----D---VARDCQRL-----VALLSSRLTG-QHRAWLQA-QGGW-----
A0A2K5TKG9_BCL2L10      ----D---VARDCQRL-----VALLSSRLAG-QHRAWLQA-QGGW-----
F7H6U5_BCL2L10-01       ----D---VARDCQRL-----VALLSSRLAG-QHRAWLQA-QGGW-----
A0A2K6B2D9_BCL2L10      ----D---VARDCQRL-----VALLSSRLAG-QHRAWLQA-QGGW-----
A0A2K5MMZ4_BCL2L10      ----D---VARDCQRL-----VALLSSRLAG-QHRAWLQA-QGGW-----
H2NN92_BCL2L10-01       ----D---VARDCQRL-----VALLSSRLVG-QHRAWLQA-QGGW-----
G3QLU6_BCL2L10-01       ----D---VARDCQRL-----VALLSSRLMG-QHRAWLQA-QGGW-----
A0A2R9BCD9_BCL2L10      ----D---VARDCQRL-----VALLSSRLVG-QHRAWLQA-QGGW-----
H2Q9G4_BCL2L10-01       ----D---VARDCQRL-----VALLSSRLVG-QHRAWLQA-QGGW-----
Q9HD36_BCL2L10-01       ----D---VARDCQRL-----VALLSSRLMG-QHRAWLQA-QGGW-----
A0A337RYG8_BCL2L10      ----N---VGQDCQHL-----VALLCNRLTG-RHRAWLEA-HDGW-----
G1LKR4_BCL2L10-01       ----G---VRQDCRHL-----VDFLCNRLTG-QHRAWLEA-HDGW-----
A0A452QJG0_BCL2L10      ----G---VRQDCRHL-----VDFLCNRLTG-QHRAWLEA-HDGW-----
P70345_BCL2L2-03        ----M----------------VA-----YLETRLADWIHS-SGGW-----
A0A2I3T6T8_BCL2A1-      ----L----------------TAASTSTAQENGFVKKFEH-KSGW-----
                                                                          

G1MZW1_BCL2-01          -------DA-----------------------FV----------------
A0A3Q0RA11_MCL1-02      -------DG-----------------------FV----------------
I3KXG5_MCL1-01          -------DG-----------------------FV----------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          -------EG-----------------------FV----------------
K7FPN7_MCL1-01          -------EG-----------------------FV----------------
F6VJQ0_BCL2L10-01       -------TG-----------------------FH----------------
A0A3Q1GS47_BCL2L1-      -------ER-----------------------FA----------------
A0A2K5DMS4_MCL1-01      -------DG-----------------------FV----------------
A0A3P8V8T6_MCL1-01      -------DG-----------------------FV----------------
B6V6J0_MCL1-01          -------DG-----------------------FV----------------
F7ETY1_MCL1-01          -------EG-----------------------FV----------------
A0A287APJ6_BCL2-01      --------------------------------------------------
H3AR18_MCL1-01          -------KG-----------------------FV----------------
F7G4L5_BCL2L2-04        --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
W5QDH5_BCL2L2-01        --------------------------------------------------
D3Z5F7_BCL2L2-01        --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-05        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-01        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
J7H260_MCL1-01          -------DG-----------------------CV----------------
H0XHA5_MCL1-01          -------DG-----------------------FV----------------
R4GAJ0_MCL1-01          -------HN-----------------------CV----------------
R4GAJ0_MCL1-02          -------EG-----------------------FV----------------
G1QAV8_MCL1-01          -------DG-----------------------FV----------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
M3XAP4_MCL1-03          -------DG-----------------------FV----------------
A0A2K6GI15_MCL1-03      -------DG-----------------------FV----------------
C8YZ26_MCL1-01          -------DG-----------------------FV----------------
A0A2K5CFH3_MCL1-02      -------DG-----------------------FV----------------
F7GTF7_MCL1-03          -------DG-----------------------FV----------------
A0A2K6V5Y3_MCL1-03      -------DG-----------------------FV----------------
A0A2K5LXU8_MCL1-03      -------DG-----------------------FV----------------
A0A2K5I9Q7_MCL1-03      -------DG-----------------------FV----------------
A0A2I2YQH7_MCL1-03      -------DG-----------------------FV----------------
Q07820_MCL1-04          -------DG-----------------------FV----------------
A0A2K5W0W9_MCL1-03      -------DG-----------------------FV----------------
F7HUE9_MCL1-02          -------DG-----------------------FV----------------
A0A2K6ECR0_MCL1-03      -------DG-----------------------FV----------------
A0A2K5XSC7_MCL1-03      -------DG-----------------------FV----------------
A0A2R9BYH6_MCL1-03      -------DG-----------------------FV----------------
K7DE58_MCL1-03          -------DG-----------------------FV----------------
A0A2I3M3D6_MCL1-03      -------DG-----------------------FV----------------
A0A2K6KRW9_MCL1-03      -------DG-----------------------FV----------------
A0A2K6PPL1_MCL1-03      -------DG-----------------------FV----------------
K7DE58_MCL1-04          -------DG-----------------------FV----------------
A0A2I3GB35_MCL1-03      -------DG-----------------------FV----------------
G2HFR3_MCL1-01          -------DG-----------------------FV----------------
A0A1L1RNM6_MCL1-01      -------EG-----------------------FV----------------
A0A1L1RNM6_MCL1-02      -------EG-----------------------FV----------------
F6ZMX1_MCL1-01          -------EG-----------------------FV----------------
A0A286Y1M5_MCL1-01      -------DG-----------------------FV----------------
P97287_MCL1-02          -------DG-----------------------FV----------------
P97287_MCL1-01          -------DG-----------------------FV----------------
G3T756_MCL1-01          -------DG-----------------------FV----------------
G1L3M8_MCL1-02          -------DG-----------------------FV----------------
A0A2U3V2H3_MCL1-01      -------DG-----------------------FV----------------
K9IWB2_MCL1-03          -------DG-----------------------FV----------------
K9IWB2_MCL1-02          -------DG-----------------------FV----------------
K9IWB2_MCL1-01          -------DG-----------------------FV----------------
B4DU51_MCL1-01          -------DG-----------------------FV----------------
A0A287DCH9_MCL1-02      -------DG-----------------------FV----------------
A0A287DCH9_MCL1-01      -------DG-----------------------FV----------------
A0A452GAH0_MCL1-02      -------DG-----------------------FV----------------
A0A2K5I9Q7_MCL1-01      -------DG-----------------------FV----------------
G1PZ39_MCL1-01          ----GFKDG-----------------------FV----------------
Q95KR3_MCL1-01          -------DG-----------------------FV----------------
A0A2K5EPY9_MCL1-02      -------DG-----------------------FV----------------
A0A2K5EPY9_MCL1-01      -------DG-----------------------FV----------------
J9PBC4_MCL1-01          -------DG-----------------------GVWGEWSTPSDLKGESRK
A0A2K5C7L5_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          -------DG-----------------------FV----------------
A5PJR2_MCL1-01          -------DG-----------------------FV----------------
A0A452GAH0_MCL1-01      -------DG-----------------------FV----------------
G1L3M8_MCL1-01          -------DG-----------------------FV----------------
F7AVA6_MCL1-01          -------DG-----------------------FV----------------
G1T2Q0_MCL1-02          -------DG-----------------------FV----------------
G1T2Q0_MCL1-01          -------DG-----------------------FV----------------
M3XAP4_MCL1-01          -------DG-----------------------FV----------------
Q7YRZ9_MCL1-01          -------DG-----------------------FV----------------
J9PBC4_MCL1-02          -------DG-----------------------FV----------------
Q8HYS5_MCL1-01          -------DG-----------------------FV----------------
M3XZZ5_MCL1-01          -------DG-----------------------FV----------------
A0A452RHX5_MCL1-01      -------DG-----------------------FV----------------
H0XFB7_MCL1-01          -------DG-----------------------FV----------------
A0A2K6GI15_MCL1-02      -------DG-----------------------FV----------------
F7GTF7_MCL1-02          -------DG-----------------------FV----------------
A0A2K5CFH3_MCL1-01      -------DG-----------------------FV----------------
A0A2K6V5Y3_MCL1-01      -------DG-----------------------FV----------------
A0A2K6KRW9_MCL1-01      -------DG-----------------------FV----------------
A0A2K6PPL1_MCL1-01      -------DG-----------------------FV----------------
A0A2K5XSC7_MCL1-01      -------DG-----------------------FV----------------
A0A0D9RZP5_MCL1-01      -------DG-----------------------FV----------------
A0A2K5W0W9_MCL1-02      -------DG-----------------------FV----------------
I7G687_MCL1-01          -------DG-----------------------FV----------------
F7HUE9_MCL1-01          -------DG-----------------------FV----------------
A0A2K6ECR0_MCL1-01      -------DG-----------------------FV----------------
A0A2I3M3D6_MCL1-02      -------DG-----------------------FV----------------
A0A2K5LXU8_MCL1-01      -------DG-----------------------FV----------------
A0A2I3GB35_MCL1-02      -------DG-----------------------FV----------------
H2N5Y9_MCL1-01          -------DG-----------------------FV----------------
Q07820_MCL1-01          -------DG-----------------------FV----------------
A0A2R9BYH6_MCL1-01      -------DG-----------------------FV----------------
K7DE58_MCL1-01          -------DG-----------------------FV----------------
A0A2I2YQH7_MCL1-01      -------DG-----------------------FV----------------
A0A2K5I9Q7_MCL1-02      --------------------------------------------------
M3XAP4_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K6V5Y3_MCL1-02      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPL1_MCL1-02      --------------------------------------------------
A0A2K5LXU8_MCL1-02      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3M3D6_MCL1-01      --------------------------------------------------
A0A2K5XSC7_MCL1-02      --------------------------------------------------
A0A2I3GB35_MCL1-01      --------------------------------------------------
Q07820_MCL1-03          --------------------------------------------------
A0A2R9BYH6_MCL1-02      --------------------------------------------------
K7DE58_MCL1-02          --------------------------------------------------
A0A2I2YQH7_MCL1-02      --------------------------------------------------
G3WBC5_MCL1-01          -------EG-----------------------FV----------------
W5QI41_MCL1-01          -------DG-----------------------FV----------------
F1MQX4_MCL1-01          -------DG-----------------------FV----------------
B4DLY8_MCL1-01          -------DG-----------------------FV----------------
B4DG83_MCL1-01          -------DG-----------------------FV----------------
B4E3L8_MCL1-01          -------DG-----------------------FV----------------
F8W4Q8_MCL1-02          -------DG-----------------------FV----------------
G1QEX2_BCL2L10-01       -------DG-----------------------FC----------------
H3AAS7_BCL2L2-02        -------SA-----------------------FV----------------
H3AAS7_BCL2L2-01        -------SA-----------------------FV----------------
F6TEC3_BCL2L2-01        -------NG-----------------------FL----------------
G1Q051_BCL2L2-01        -------AE-----------------------FT----------------
G3WPT2_BCL2L2-01        -------AE-----------------------FT----------------
P70345_BCL2L2-01        -------AE-----------------------FT----------------
O88996_BCL2L2-01        -------AE-----------------------FT----------------
A0A3Q9B4M8_BCL2L2-      -------AE-----------------------FT----------------
H0XR82_BCL2L2-01        -------AE-----------------------FT----------------
Q92843_BCL2L2-02        -------AE-----------------------FT----------------
Q05KI8_BCL2L2-01        -------AE-----------------------FT----------------
Q1RMX3_BCL2L2-01        -------AE-----------------------FT----------------
Q45T69_BCL2L2-01        -------AE-----------------------FT----------------
A0A452ECF0_BCL2L2-      -------AE-----------------------FT----------------
A0A286XQQ9_BCL2L2-      -------AE-----------------------FT----------------
A0A2K5MZX9_BCL2L2-      -------AE-----------------------FT----------------
A0A0D9RU30_BCL2L2-      -------AE-----------------------FT----------------
A0A2K5HEK7_BCL2L2-      -------AE-----------------------FT----------------
F6PH48_BCL2L2-01        -------AE-----------------------FT----------------
A0A2I2UAE3_BCL2L2-      -------AE-----------------------FT----------------
A0A2I2YPX6_BCL2L2-      -------AE-----------------------FT----------------
I3ND50_BCL2L2-01        -------AE-----------------------FT----------------
A0A2K5V0Q3_BCL2L2-      -------AE-----------------------FT----------------
F7G4L5_BCL2L2-02        -------AE-----------------------FT----------------
F7G4L5_BCL2L2-03        -------AE-----------------------FT----------------
A0A2K6EA73_BCL2L2-      -------AE-----------------------FT----------------
A0A2K6AI30_BCL2L2-      -------AE-----------------------FT----------------
G1RYB4_BCL2L2-03        -------AE-----------------------FT----------------
A0A2R9A7B2_BCL2L2-      -------AE-----------------------FT----------------
H2Q805_BCL2L2-01        -------AE-----------------------FT----------------
A0A2I3MUE4_BCL2L2-      -------AE-----------------------FT----------------
A0A2K6GWN0_BCL2L2-      -------AE-----------------------FT----------------
A0A2K6MEE6_BCL2L2-      -------AE-----------------------FT----------------
A0A2K6RW46_BCL2L2-      -------AE-----------------------FT----------------
A0A2K6RW46_BCL2L2-      -------AE-----------------------FT----------------
A0A2K6TM77_BCL2L2-      -------AE-----------------------FT----------------
A0A287AW74_BCL2L2-      -------AE-----------------------FT----------------
A0A2U4CFE3_BCL2L2-      -------AE-----------------------FT----------------
A0A452SHI1_BCL2L2-      -------AE-----------------------FT----------------
A0A384DPS8_BCL2L2-      -------AE-----------------------FT----------------
F6U940_BCL2L2-01        -------AE-----------------------FT----------------
G3WPT2_BCL2L2-02        -------AE-----------------------FT----------------
W5QDH5_BCL2L2-02        -------AE-----------------------FT----------------
Q7TS60_BCL2L2-01        -------AE-----------------------FT----------------
G1LMC3_BCL2L2-01        -------AE-----------------------FT----------------
M3Y5X5_BCL2L2-01        -------AE-----------------------FT----------------
G1P3J2_BCL2L2-01        -------AE-----------------------FT----------------
I3ND50_BCL2L2-02        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
Q6GLI5_BCL2L1-01        -------EA-----------------------FV----------------
Q2TAP5_BCL2L1-01        -------EA-----------------------FV----------------
Q91828_BCL2L1-01        -------EA-----------------------FV----------------
I7GKS6_BCL2L1-01        -------DT-----------------------FV----------------
A0A2K5EBP4_BCL2L1-      -------DT-----------------------FV----------------
A0A2K6UWY8_BCL2L1-      -------DT-----------------------FV----------------
A0A3Q1LRT3_BCL2L1-      -------DT-----------------------FV----------------
A0A2K5M8B1_BCL2L1-      -------DT-----------------------FV----------------
A0A2K5H963_BCL2L1-      -------DT-----------------------FV----------------
G3RY91_BCL2L1-02        -------DT-----------------------FV----------------
A0A2K5VPG2_BCL2L1-      -------DT-----------------------FV----------------
F6UKR4_BCL2L1-02        -------DT-----------------------FV----------------
A0A2K5YR37_BCL2L1-      -------DT-----------------------FV----------------
A0A2K6LPM4_BCL2L1-      -------DT-----------------------FV----------------
A0A2K6QFA2_BCL2L1-      -------DT-----------------------FV----------------
A0A2K6G3C5_BCL2L1-      -------DT-----------------------FV----------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        ---------------------------------L----------------
Q07817_BCL2L1-02        -------DT-----------------------FV----------------
A0A2K5YR37_BCL2L1-      -------DT-----------------------FV----------------
A0A452E1B1_BCL2L1-      -------DI-----------------------FV----------------
W5PSA5_BCL2L1-01        -------DI-----------------------FV----------------
Q07816_BCL2L1-01        -------ER-----------------------FV----------------
Q07816_BCL2L1-03        -------ER-----------------------FV----------------
Q07816_BCL2L1-02        -------ER-----------------------FV----------------
G1N5N5_BCL2L1-01        -------ER-----------------------FV----------------
A0A452ILL8_BCL2L1-      -------ER-----------------------FV----------------
A0A452ILL8_BCL2L1-      -------ER-----------------------FV----------------
K7F655_BCL2L1-01        -------ER-----------------------FV----------------
A0A287CZ07_BCL2L1-      -------DT-----------------------FV----------------
F6WA14_BCL2L1-01        -------DT-----------------------FV----------------
G3WKX6_BCL2L1-01        -------DT-----------------------FV----------------
F6WQI0_BCL2L1-02        GTFCYFVSS-----------------------LM----------------
G3SPN0_BCL2L1-01        -------VR-----------------------TT----------------
H0X6V2_BCL2L1-01        ----WRCQA-----------------------FP----------------
Q2PFS6_BCL2L1-01        -------DT-----------------------FV----------------
P53563_BCL2L1-02        -------VR-----------------------TT----------------
P53563_BCL2L1-03        -------VR-----------------------TT----------------
O35843_BCL2L1-01        -------GV-----------------------------------------
G1RER8_BCL2L1-01        -------DT-----------------------FV----------------
Q64373_BCL2L1-01        -------DT-----------------------FV----------------
Q64373_BCL2L1-09        -------DT-----------------------FV----------------
P53563_BCL2L1-01        -------DT-----------------------FV----------------
A0A2U3V0P1_BCL2L1-      -------DT-----------------------FV----------------
O77737_BCL2L1-01        -------DT-----------------------FV----------------
Q9MYW4_BCL2L1-01        -------DT-----------------------FV----------------
F6WQI0_BCL2L1-01        -------DT-----------------------FV----------------
B2Z3Z4_BCL2L1-01        -------DT-----------------------FV----------------
Q05KJ0_BCL2L1-02        -------DT-----------------------FV----------------
Q05KJ0_BCL2L1-01        -------DT-----------------------FV----------------
E2IV76_BCL2L1-01        -------DT-----------------------FV----------------
A0A2K6G3C5_BCL2L1-      -------DT-----------------------FV----------------
M3Z2H9_BCL2L1-01        -------DT-----------------------FV----------------
A0A0D9RJZ8_BCL2L1-      -------DT-----------------------FV----------------
A0A286Y5D6_BCL2L1-      -------DT-----------------------FV----------------
A0A1L5BWY3_BCL2L1-      -------DT-----------------------FV----------------
I3MUP5_BCL2L1-03        -------DT-----------------------FV----------------
I3MUP5_BCL2L1-01        -------DT-----------------------FV----------------
I3MUP5_BCL2L1-02        -------DT-----------------------FV----------------
G1P9D2_BCL2L1-01        -------DT-----------------------FV----------------
A0A2K5EBP4_BCL2L1-      -------DT-----------------------FV----------------
E2IV75_BCL2L1-01        -------DT-----------------------FV----------------
F7IT34_BCL2L1-01        -------DT-----------------------FV----------------
F7IT34_BCL2L1-02        -------DT-----------------------FV----------------
Q76LT7_BCL2L1-01        -------DT-----------------------FV----------------
A0A2K5M8B1_BCL2L1-      -------DT-----------------------FV----------------
A0A2K5H963_BCL2L1-      -------DT-----------------------FV----------------
M3XA94_BCL2L1-01        -------DT-----------------------FV----------------
Q8SQ42_BCL2L1-01        -------DT-----------------------FV----------------
G3RY91_BCL2L1-01        -------DT-----------------------FV----------------
Q07817_BCL2L1-01        -------DT-----------------------FV----------------
Q07817_BCL2L1-03        -------DT-----------------------FV----------------
A0A2K5VPG2_BCL2L1-      -------DT-----------------------FV----------------
F6UKR4_BCL2L1-01        -------DT-----------------------FV----------------
A0A2K5YR37_BCL2L1-      -------DT-----------------------FV----------------
A0A2J8VIH3_BCL2L1-      -------DT-----------------------FV----------------
A0A2K6LPM4_BCL2L1-      -------DT-----------------------FV----------------
A0A2K6QFA2_BCL2L1-      -------DT-----------------------FV----------------
A0A2K6QFA2_BCL2L1-      -------DT-----------------------FV----------------
A0A2K6UWY8_BCL2L1-      -------DT-----------------------FV----------------
E2IV77_BCL2L1-01        -------DT-----------------------FV----------------
A0A452SDS4_BCL2L1-      -------DT-----------------------FV----------------
A0A384D3U1_BCL2L1-      -------DT-----------------------FV----------------
A0A452FWV3_BCL2L1-