Dataset for protein Bcl-w of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

81 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P70345_BCL2L2-03        --------------------------------------------------
F7G4L5_BCL2L2-04        --------------------------------------MPLLILSPYIHA
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
W5QDH5_BCL2L2-01        -------------------------------MGWPNLKYLLLGLSPYIHA
D3Z5F7_BCL2L2-01        --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-05        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-01        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        ------------MPSARNSPLPRQSAAPQPCCLAPCPSRPPGSPPDAPPR
G1TV33_BCL2L2-01        ------------LSLCLHIPDIHAGLSSLPLT------------------
A0A2K5CWZ4_BCL2L2-      ------------MPLLVLCPYIHASLSSLPLI------------------
A0A2R8M4C0_BCL2L2-      --------------LLVLCPYINASLSSLPLI------------------
G3TMU7_BCL2L2-01        --------------------YIHVSLSSLTLA------------------
A0A2K5CWZ4_BCL2L2-      ------------------------HLSSLPLI------------------
A0A2K6TM77_BCL2L2-      ------------------------HLSSLPLI------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
F6TEC3_BCL2L2-01        RKKGNNGVKDRDWEEQHATGNIIFRGSPDKYL------------------
G1Q051_BCL2L2-01        ---------MNEFSLDNFMLYSFDSVDIRPKV------------------
G3WPT2_BCL2L2-01        -------------------HSSSPIFFSLPFI------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
F6PH48_BCL2L2-01        --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
I3ND50_BCL2L2-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-03        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
F6U940_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-02        --------------------------------------------------
W5QDH5_BCL2L2-02        -----MGWPNLKYLLLGLSPYIHASLLCLTPT------------------
Q7TS60_BCL2L2-01        ---------MSLFGLCQYFSYIYVSLSSLPLS------------------
G1LMC3_BCL2L2-01        -------------------PYIHASLSSLTLT------------------
M3Y5X5_BCL2L2-01        ---------KPEAPLLAFQPYIHASLSSLTLT------------------
G1P3J2_BCL2L2-01        ---------PEMLHSVSLTKYTHASLLSLTFT------------------
I3ND50_BCL2L2-02        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
                                                                          

P70345_BCL2L2-03        --------------------------------------------------
F7G4L5_BCL2L2-04        SVSSLPLIAARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6GWN0_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2R8M4C0_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGTGPGEGP
A0A2K5CWZ4_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2I2YPX6_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6TM77_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
W5QDH5_BCL2L2-01        SLLCLTPTAARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
D3Z5F7_BCL2L2-01        -----------MATPAST--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6MEE6_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6RW46_BCL2L2-      -----------MATPASA--PDTRALVADFLGYKLRQKGYVCGAGPGEGP
A0A384DPS8_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K5MZX9_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K5HEK7_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K5V0Q3_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
F7G4L5_BCL2L2-05        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6EA73_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6AI30_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
G1RYB4_BCL2L2-01        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2R9A7B2_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
H2Q805_BCL2L2-02        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2I3MUE4_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A287AW74_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A384DPS8_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
Q5XGJ4_BCL2L2-01        --------MAQSE-------LGSRALVEDFVRYKLCQRSLVPEPA---GA
F7G6M3_BCL2L2-01        PPPPRCPAAPRMATPAPASVSDTRALVADFVGYKLRQKGFACGAGPGEGP
G1TV33_BCL2L2-01        --------AARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K5CWZ4_BCL2L2-      --------AARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2R8M4C0_BCL2L2-      --------AARMATPASA--PDTRALVADFVGYKLRQKGYVCGTGPGEGP
G3TMU7_BCL2L2-01        --------AARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K5CWZ4_BCL2L2-      --------AARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6TM77_BCL2L2-      --------AARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
H3AAS7_BCL2L2-02        --------------MDSL--YSNRGVVEDFIYYKLGQKGYSQQGAPTD-P
H3AAS7_BCL2L2-01        --------------MDSL--YSNRGVVEDFIYYKLGQKGYSQQGAPTD-P
F6TEC3_BCL2L2-01        --------TEQGWMAQSE--LGSRALVEDFVRYKLCQRSLVPEPA---GA
G1Q051_BCL2L2-01        --------LGPKSSQPQA--PDTQALVADFVGYKLRQKGYVCGAGPGEGP
G3WPT2_BCL2L2-01        --------ASQMATPASA--PDTRALVADFVGYKLRQKGYACGTGPGEGP
P70345_BCL2L2-01        -----------MATPAST--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
O88996_BCL2L2-01        -----------MATPAST--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A3Q9B4M8_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKMRQKGYVCGAGPGEGP
H0XR82_BCL2L2-01        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
Q92843_BCL2L2-02        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
Q05KI8_BCL2L2-01        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
Q1RMX3_BCL2L2-01        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
Q45T69_BCL2L2-01        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A452ECF0_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A286XQQ9_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K5MZX9_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A0D9RU30_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K5HEK7_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
F6PH48_BCL2L2-01        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2I2UAE3_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2I2YPX6_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
I3ND50_BCL2L2-01        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K5V0Q3_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
F7G4L5_BCL2L2-02        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
F7G4L5_BCL2L2-03        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6EA73_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6AI30_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
G1RYB4_BCL2L2-03        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2R9A7B2_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
H2Q805_BCL2L2-01        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2I3MUE4_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6GWN0_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6MEE6_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2K6RW46_BCL2L2-      -----------MATPASA--PDTRALVADFLGYKLRQKGYVCGAGPGEGP
A0A2K6RW46_BCL2L2-      -----------MATPASA--PDTRALVADFLGYKLRQKGYVCGAGPGEGP
A0A2K6TM77_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A287AW74_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A2U4CFE3_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A452SHI1_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
A0A384DPS8_BCL2L2-      -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
F6U940_BCL2L2-01        -----------MATPASA--PDTRALVADFVGYKLRQKGYACGTGPGEGP
G3WPT2_BCL2L2-02        -----------MATPASA--PDTRALVADFVGYKLRQKGYACGTGPGEGP
W5QDH5_BCL2L2-02        --------AARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
Q7TS60_BCL2L2-01        --------AARMATPAST--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
G1LMC3_BCL2L2-01        --------AARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
M3Y5X5_BCL2L2-01        --------AARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
G1P3J2_BCL2L2-01        --------AARMATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
I3ND50_BCL2L2-02        -----------MATPASA--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
P70345_BCL2L2-04        -----------MATPAST--PDTRALVADFVGYKLRQKGYVCGAGPGEGP
                                                                          

P70345_BCL2L2-03        --------------------------------------------------
F7G4L5_BCL2L2-04        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6GWN0_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2R8M4C0_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K5CWZ4_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2I2YPX6_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6TM77_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
W5QDH5_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
D3Z5F7_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6MEE6_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6RW46_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A384DPS8_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K5MZX9_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K5HEK7_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K5V0Q3_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
F7G4L5_BCL2L2-05        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6EA73_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6AI30_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
G1RYB4_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2R9A7B2_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
H2Q805_BCL2L2-02        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2I3MUE4_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A287AW74_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A384DPS8_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
Q5XGJ4_BCL2L2-01        ASCSLHSAMRAAGDEFEERFRQAFSEISTQIHVTPGTAYARFAEVAGSLF
F7G6M3_BCL2L2-01        PAQPLHRAMRAAGDEFESRFRRAFSDLASQLHVTPGSAQQRFTQVSDELF
G1TV33_BCL2L2-01        AANPLHQAMRAAGDEFETRFRQNFSDLAAQLHVTPGSAQQSFTQVCDELF
A0A2K5CWZ4_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2R8M4C0_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
G3TMU7_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K5CWZ4_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6TM77_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
H3AAS7_BCL2L2-02        PANPLYRAMREAGDEFEARFHRTFNSLSSHLHITPGTAYRRFAETADSLF
H3AAS7_BCL2L2-01        PANPLYRAMREAGDEFEARFHRTFNSLSSHLHITPGTAYRRFAETADSLF
F6TEC3_BCL2L2-01        ASCSLHSAMRAAGDEFEERFRQAFSEISTQIHVTPGTAYARFAEVAGSLF
G1Q051_BCL2L2-01        AADPLHQAMRAAGDEFETHFRCTFSDLVAQLHVTPGSAQQCFTQVSDELF
G3WPT2_BCL2L2-01        TNEPLHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
P70345_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
O88996_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A3Q9B4M8_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
H0XR82_BCL2L2-01        ATDPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
Q92843_BCL2L2-02        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
Q05KI8_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
Q1RMX3_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
Q45T69_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A452ECF0_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A286XQQ9_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K5MZX9_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A0D9RU30_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K5HEK7_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
F6PH48_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2I2UAE3_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2I2YPX6_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
I3ND50_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K5V0Q3_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
F7G4L5_BCL2L2-02        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
F7G4L5_BCL2L2-03        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6EA73_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6AI30_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
G1RYB4_BCL2L2-03        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2R9A7B2_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
H2Q805_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2I3MUE4_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6GWN0_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6MEE6_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6RW46_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6RW46_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2K6TM77_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A287AW74_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A2U4CFE3_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A452SHI1_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
A0A384DPS8_BCL2L2-      AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
F6U940_BCL2L2-01        TTEPLHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
G3WPT2_BCL2L2-02        TNEPLHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
W5QDH5_BCL2L2-02        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
Q7TS60_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
G1LMC3_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
M3Y5X5_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
G1P3J2_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
I3ND50_BCL2L2-02        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
P70345_BCL2L2-04        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELF
                                                                          

P70345_BCL2L2-03        ---------------------------MEPLVGQVQDWMVAYLETRLADW
F7G4L5_BCL2L2-04        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6GWN0_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2R8M4C0_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K5CWZ4_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2I2YPX6_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6TM77_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
W5QDH5_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
D3Z5F7_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADW
A0A2K6MEE6_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6RW46_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A384DPS8_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K5MZX9_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K5HEK7_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K5V0Q3_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
F7G4L5_BCL2L2-05        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6EA73_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6AI30_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
G1RYB4_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2R9A7B2_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
H2Q805_BCL2L2-02        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2I3MUE4_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A287AW74_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADW
A0A384DPS8_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
Q5XGJ4_BCL2L2-01        QGGVNWGRIVAFFVFGAALCAESVNKEMSPLLPRIQDWMVTYLETNLRDW
F7G6M3_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLDTQLADW
G1TV33_BCL2L2-01        QRGPNWGRVVAFFAFGAALCAESVNKEMEPLVGQVQEWMVTYLETQLAGW
A0A2K5CWZ4_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2R8M4C0_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
G3TMU7_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVVYLETRLADW
A0A2K5CWZ4_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6TM77_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
H3AAS7_BCL2L2-02        QDGVNWGRVVALFVFSAALCVESVDKEMASLVGRIIDWTVTYVESSLQDW
H3AAS7_BCL2L2-01        QDGVNWGRVVALFVFSAALCVESVDKEMASLVGRIIDWTVTYVESSLQDW
F6TEC3_BCL2L2-01        QGGVNWGRIVAFFVFGAALCAESVNKEMSPLLPRIQDWMVTYLETNLRDW
G1Q051_BCL2L2-01        QGGPNWGYLVAFFVFGAALCVESVNKEMEPLVGQVQEWTVAYLEMRLADW
G3WPT2_BCL2L2-01        QGGANWGRLVAFFVFGAALCAESVNKEMEPLVGQEKRYGVHLKQGILARY
P70345_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADW
O88996_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADW
A0A3Q9B4M8_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVPEWMVTYLETRLADW
H0XR82_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
Q92843_BCL2L2-02        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADW
Q05KI8_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
Q1RMX3_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
Q45T69_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A452ECF0_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A286XQQ9_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMQPLVGQVQEWMVAYLETRLADW
A0A2K5MZX9_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A0D9RU30_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K5HEK7_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
F6PH48_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2I2UAE3_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2I2YPX6_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
I3ND50_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K5V0Q3_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
F7G4L5_BCL2L2-02        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
F7G4L5_BCL2L2-03        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6EA73_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6AI30_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
G1RYB4_BCL2L2-03        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2R9A7B2_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
H2Q805_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2I3MUE4_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6GWN0_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6MEE6_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6RW46_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6RW46_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A2K6TM77_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A287AW74_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADW
A0A2U4CFE3_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A452SHI1_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
A0A384DPS8_BCL2L2-      QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
F6U940_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQLADW
G3WPT2_BCL2L2-02        QGGANWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQLADW
W5QDH5_BCL2L2-02        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
Q7TS60_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADW
G1LMC3_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
M3Y5X5_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
G1P3J2_BCL2L2-01        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
I3ND50_BCL2L2-02        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
P70345_BCL2L2-04        QGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADW
                                                   * .*: .   : *   :  *  :

P70345_BCL2L2-03        IHSSGGW---------------------------------AEFTALYGDG
F7G4L5_BCL2L2-04        IHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEELEAIKARVRE
A0A2K6GWN0_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A2R8M4C0_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A2K5CWZ4_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A2I2YPX6_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A2K6TM77_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
W5QDH5_BCL2L2-01        IHSSGGW--------------------------------ELEAIKARVRE
D3Z5F7_BCL2L2-01        IHSSGGW--------------------------------ELEAIKARVRE
A0A2K6MEE6_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A2K6RW46_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A384DPS8_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A2K5MZX9_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A2K5HEK7_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A2K5V0Q3_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
F7G4L5_BCL2L2-05        IHSSGGW--------------------------------ELEAIKARVRE
A0A2K6EA73_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A2K6AI30_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
G1RYB4_BCL2L2-01        IHSSGGW--------------------------------ELEAIKARVRE
A0A2R9A7B2_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
H2Q805_BCL2L2-02        IHSSGGW--------------------------------ELEAIKARVRE
A0A2I3MUE4_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A287AW74_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
A0A384DPS8_BCL2L2-      IHSSGGW--------------------------------ELEAIKARVRE
Q5XGJ4_BCL2L2-01        IQSNGGW---------------------------------NGFLTLYGDG
F7G6M3_BCL2L2-01        IRSSGGW---------------------------------AEFTALYGDG
G1TV33_BCL2L2-01        IHSTGGW---------------------------------AEFTALYGDR
A0A2K5CWZ4_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2R8M4C0_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
G3TMU7_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
A0A2K5CWZ4_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2K6TM77_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
H3AAS7_BCL2L2-02        INHSGGW---------------------------------SAFVCLYGNG
H3AAS7_BCL2L2-01        INHSGGW---------------------------------SAFVCLYGNG
F6TEC3_BCL2L2-01        IQSNGGW---------------------------------NGFLTLYGDG
G1Q051_BCL2L2-01        IHSIGGW---------------------------------AEFTALYG--
G3WPT2_BCL2L2-01        LPSKAGA---------------------------------AEFTALYGDG
P70345_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
O88996_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
A0A3Q9B4M8_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
H0XR82_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
Q92843_BCL2L2-02        IHSSGGW---------------------------------AEFTALYGDG
Q05KI8_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGVG
Q1RMX3_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
Q45T69_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
A0A452ECF0_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A286XQQ9_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2K5MZX9_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A0D9RU30_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2K5HEK7_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
F6PH48_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
A0A2I2UAE3_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2I2YPX6_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
I3ND50_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
A0A2K5V0Q3_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
F7G4L5_BCL2L2-02        IHSSGGW---------------------------------AEFTALYGDG
F7G4L5_BCL2L2-03        IHSSGGW---------------------------------AEFTALYGDG
A0A2K6EA73_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2K6AI30_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
G1RYB4_BCL2L2-03        IHSSGGW---------------------------------AEFTALYGDG
A0A2R9A7B2_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
H2Q805_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
A0A2I3MUE4_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2K6GWN0_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2K6MEE6_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2K6RW46_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2K6RW46_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2K6TM77_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A287AW74_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A2U4CFE3_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A452SHI1_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
A0A384DPS8_BCL2L2-      IHSSGGW---------------------------------AEFTALYGDG
F6U940_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
G3WPT2_BCL2L2-02        IHSSGGW---------------------------------AEFTALYGDG
W5QDH5_BCL2L2-02        IHSSGGW---------------------------------AEFTALYGDG
Q7TS60_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
G1LMC3_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
M3Y5X5_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
G1P3J2_BCL2L2-01        IHSSGGW---------------------------------AEFTALYGDG
I3ND50_BCL2L2-02        IHSSGGW--------------------------------------LFS--
P70345_BCL2L2-04        IHSSGGW--------------------------------------VRSSQ
                        :   .*                                            

P70345_BCL2L2-03        ALEEARRLRE---------------GNWASV------------RTVLTGA
F7G4L5_BCL2L2-04        MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2K6GWN0_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2R8M4C0_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2K5CWZ4_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2I2YPX6_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2K6TM77_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
W5QDH5_BCL2L2-01        MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
D3Z5F7_BCL2L2-01        MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARSIYVGN
A0A2K6MEE6_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2K6RW46_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A384DPS8_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2K5MZX9_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2K5HEK7_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2K5V0Q3_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
F7G4L5_BCL2L2-05        MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2K6EA73_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2K6AI30_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
G1RYB4_BCL2L2-01        MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2R9A7B2_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
H2Q805_BCL2L2-02        MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A2I3MUE4_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A287AW74_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
A0A384DPS8_BCL2L2-      MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGN
Q5XGJ4_BCL2L2-01        AIEEARRQRE---------------GNWASL------------KTVLTGA
F7G6M3_BCL2L2-01        ALEDARRLRE---------------GNWASV------------RTVLTGA
G1TV33_BCL2L2-01        ALEEARRLRE---------------GTWASV------------RTVLTGA
A0A2K5CWZ4_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2R8M4C0_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
G3TMU7_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K5CWZ4_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K6TM77_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
H3AAS7_BCL2L2-02        AVGGARRFQE---------------GYWSSM------------KTVVTGA
H3AAS7_BCL2L2-01        AVGGARRFQE---------------GYWSSM------------KTVVTGA
F6TEC3_BCL2L2-01        AIEEARRQRE---------------GNWASL------------KTVLTGA
G1Q051_BCL2L2-01        --------------------------NWASV------------RTVLTGA
G3WPT2_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
P70345_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
O88996_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A3Q9B4M8_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
H0XR82_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
Q92843_BCL2L2-02        ALEEARRLRE---------------GNWASV------------RTVLTGA
Q05KI8_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
Q1RMX3_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
Q45T69_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A452ECF0_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A286XQQ9_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K5MZX9_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A0D9RU30_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K5HEK7_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
F6PH48_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2I2UAE3_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2I2YPX6_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
I3ND50_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K5V0Q3_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
F7G4L5_BCL2L2-02        ALEEARRLRE---------------GNWASV------------RTVLTGA
F7G4L5_BCL2L2-03        ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K6EA73_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K6AI30_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
G1RYB4_BCL2L2-03        ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2R9A7B2_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
H2Q805_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2I3MUE4_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K6GWN0_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K6MEE6_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K6RW46_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K6RW46_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2K6TM77_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A287AW74_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A2U4CFE3_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A452SHI1_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
A0A384DPS8_BCL2L2-      ALEEARRLRE---------------GNWASV------------RTVLTGA
F6U940_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
G3WPT2_BCL2L2-02        ALEEARRLRE---------------GNWASV------------RTVLTGA
W5QDH5_BCL2L2-02        ALEEARRLRE---------------GNWASV------------RTVLTGA
Q7TS60_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
G1LMC3_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
M3Y5X5_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
G1P3J2_BCL2L2-01        ALEEARRLRE---------------GNWASV------------RTVLTGA
I3ND50_BCL2L2-02        ---------------------------RGNM------------GALIGGW
P70345_BCL2L2-04        LLLSASLYKV---------------GLHGKI------------GPLMGGW
                                                    . :             .:  * 

P70345_BCL2L2-03        VALGALVT------------------------------------------
F7G4L5_BCL2L2-04        VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2K6GWN0_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2R8M4C0_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2K5CWZ4_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2I2YPX6_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2K6TM77_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
W5QDH5_BCL2L2-01        VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
D3Z5F7_BCL2L2-01        VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2K6MEE6_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2K6RW46_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A384DPS8_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2K5MZX9_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2K5HEK7_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2K5V0Q3_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
F7G4L5_BCL2L2-05        VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2K6EA73_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2K6AI30_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
G1RYB4_BCL2L2-01        VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2R9A7B2_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
H2Q805_BCL2L2-02        VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A2I3MUE4_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A287AW74_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
A0A384DPS8_BCL2L2-      VDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRT
Q5XGJ4_BCL2L2-01        VALGALMT------------------------------------------
F7G6M3_BCL2L2-01        VALGALVT------------------------------------------
G1TV33_BCL2L2-01        VALGALVT------------------------------------------
A0A2K5CWZ4_BCL2L2-      VALGALVT------------------------------------------
A0A2R8M4C0_BCL2L2-      VALGALVT------------------------------------------
G3TMU7_BCL2L2-01        VALGALVT------------------------------------------
A0A2K5CWZ4_BCL2L2-      VALGALVT------------------------------------------
A0A2K6TM77_BCL2L2-      VALGALVT------------------------------------------
H3AAS7_BCL2L2-02        VALGAVMT------------------------------------------
H3AAS7_BCL2L2-01        VALGAVMT------------------------------------------
F6TEC3_BCL2L2-01        VALGALMT------------------------------------------
G1Q051_BCL2L2-01        LALRALLT------------------------------------------
G3WPT2_BCL2L2-01        VALGALVT------------------------------------------
P70345_BCL2L2-01        VALGALVT------------------------------------------
O88996_BCL2L2-01        VALGALVT------------------------------------------
A0A3Q9B4M8_BCL2L2-      VALGALVT------------------------------------------
H0XR82_BCL2L2-01        VALGALVT------------------------------------------
Q92843_BCL2L2-02        VALGALVT------------------------------------------
Q05KI8_BCL2L2-01        VALGALVT------------------------------------------
Q1RMX3_BCL2L2-01        VALGALVT------------------------------------------
Q45T69_BCL2L2-01        VALGALVT------------------------------------------
A0A452ECF0_BCL2L2-      VALGALVT------------------------------------------
A0A286XQQ9_BCL2L2-      VALGALVT------------------------------------------
A0A2K5MZX9_BCL2L2-      VALGALVT------------------------------------------
A0A0D9RU30_BCL2L2-      VALGALVT------------------------------------------
A0A2K5HEK7_BCL2L2-      VALGALVT------------------------------------------
F6PH48_BCL2L2-01        VALGALVT------------------------------------------
A0A2I2UAE3_BCL2L2-      VALGALVT------------------------------------------
A0A2I2YPX6_BCL2L2-      VALGALVT------------------------------------------
I3ND50_BCL2L2-01        VALGALVT------------------------------------------
A0A2K5V0Q3_BCL2L2-      VALGALVT------------------------------------------
F7G4L5_BCL2L2-02        VALGALVT------------------------------------------
F7G4L5_BCL2L2-03        VALGALVT------------------------------------------
A0A2K6EA73_BCL2L2-      VALGALVT------------------------------------------
A0A2K6AI30_BCL2L2-      VALGALVT------------------------------------------
G1RYB4_BCL2L2-03        VALGALVT------------------------------------------
A0A2R9A7B2_BCL2L2-      VALGALVT------------------------------------------
H2Q805_BCL2L2-01        VALGALVT------------------------------------------
A0A2I3MUE4_BCL2L2-      VALGALVT------------------------------------------
A0A2K6GWN0_BCL2L2-      VALGALVT------------------------------------------
A0A2K6MEE6_BCL2L2-      VALGALVT------------------------------------------
A0A2K6RW46_BCL2L2-      VALGALVT------------------------------------------
A0A2K6RW46_BCL2L2-      VALGALVT------------------------------------------
A0A2K6TM77_BCL2L2-      VALGALVT------------------------------------------
A0A287AW74_BCL2L2-      VALGALVT------------------------------------------
A0A2U4CFE3_BCL2L2-      VALGALVT------------------------------------------
A0A452SHI1_BCL2L2-      VALGALVT------------------------------------------
A0A384DPS8_BCL2L2-      VALGALVT------------------------------------------
F6U940_BCL2L2-01        VALGALVT------------------------------------------
G3WPT2_BCL2L2-02        VALGALVT------------------------------------------
W5QDH5_BCL2L2-02        VALSLAEG------------------------------------------
Q7TS60_BCL2L2-01        VALGALVT------------------------------------------
G1LMC3_BCL2L2-01        VALGALVT------------------------------------------
M3Y5X5_BCL2L2-01        VALGALVT------------------------------------------
G1P3J2_BCL2L2-01        VALGALVT------------------------------------------
I3ND50_BCL2L2-02        DSCAGKEA------------------------------------------
P70345_BCL2L2-04        -GCAGK--------------------------------------------
                                                                          

P70345_BCL2L2-03        --------------------------------------------------
F7G4L5_BCL2L2-04        SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A2K6GWN0_BCL2L2-      SLALDESLFRGRQIKVSLCFPLYILYSQVIPKRTNRPGISTTDRGFPRAR
A0A2R8M4C0_BCL2L2-      SLALDESLFRGRQIKIDFKAFIYSSLTQVIPKRTNRPGISTTDRGFPRAR
A0A2K5CWZ4_BCL2L2-      SLALDESLFRGRQIKVDFKAFIYSSLTQVIPKRTNRPGISTTDRGFPRAR
A0A2I2YPX6_BCL2L2-      SLALDESLFRGRQIKVDFKAIICSSLTQVIPKRTNRPGISTTDRGFPRAR
A0A2K6TM77_BCL2L2-      SLALDESLFRGRQIKVDFKAFIYSSLTQVIPKRTNRPGISTTDRGFPRAR
W5QDH5_BCL2L2-01        SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
D3Z5F7_BCL2L2-01        SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRSR
A0A2K6MEE6_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A2K6RW46_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A384DPS8_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A2K5MZX9_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A2K5HEK7_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A2K5V0Q3_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
F7G4L5_BCL2L2-05        SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A2K6EA73_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A2K6AI30_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
G1RYB4_BCL2L2-01        SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A2R9A7B2_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
H2Q805_BCL2L2-02        SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A2I3MUE4_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A287AW74_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
A0A384DPS8_BCL2L2-      SLALDESLFRGRQIK-------------VIPKRTNRPGISTTDRGFPRAR
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
F6TEC3_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
F6PH48_BCL2L2-01        --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
I3ND50_BCL2L2-01        --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
G1RYB4_BCL2L2-03        --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
F6U940_BCL2L2-01        --------------------------------------------------
G3WPT2_BCL2L2-02        --------------------------------------------------
W5QDH5_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
I3ND50_BCL2L2-02        --------------------------------------------------
P70345_BCL2L2-04        --------------------------------------------------
                                                                          

P70345_BCL2L2-03        ---------------------------------VGAFFASK
F7G4L5_BCL2L2-04        YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6GWN0_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2R8M4C0_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5CWZ4_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2I2YPX6_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6TM77_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
W5QDH5_BCL2L2-01        YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
D3Z5F7_BCL2L2-01        YRARTTNYNSSRSRFYSGFNSRPRGRIYRGRARATSWYSPY
A0A2K6MEE6_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
A0A2K6RW46_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
A0A384DPS8_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWFL--
A0A2K5MZX9_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5HEK7_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5V0Q3_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
F7G4L5_BCL2L2-05        YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6EA73_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6AI30_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
G1RYB4_BCL2L2-01        YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2R9A7B2_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
H2Q805_BCL2L2-02        YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2I3MUE4_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A287AW74_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A384DPS8_BCL2L2-      YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
Q5XGJ4_BCL2L2-01        ---------------------------------VGALFASK
F7G6M3_BCL2L2-01        ---------------------------------VGAFFASK
G1TV33_BCL2L2-01        ---------------------------------VGAFFASK
A0A2K5CWZ4_BCL2L2-      ---------------------------------VGAFFASK
A0A2R8M4C0_BCL2L2-      ---------------------------------VGAFFASK
G3TMU7_BCL2L2-01        ---------------------------------VGAFFASK
A0A2K5CWZ4_BCL2L2-      ---------------------------------VGAFFASK
A0A2K6TM77_BCL2L2-      ---------------------------------VGAFFASK
H3AAS7_BCL2L2-02        ---------------------------------VGALFASR
H3AAS7_BCL2L2-01        ---------------------------------VGALFASR
F6TEC3_BCL2L2-01        ---------------------------------VGALFASK
G1Q051_BCL2L2-01        ---------------------------------VGAFFASM
G3WPT2_BCL2L2-01        ---------------------------------VGAFFASK
P70345_BCL2L2-01        ---------------------------------VGAFFASK
O88996_BCL2L2-01        ---------------------------------VGAFFASK
A0A3Q9B4M8_BCL2L2-      ---------------------------------VGAFFASK
H0XR82_BCL2L2-01        ---------------------------------VGAFFASK
Q92843_BCL2L2-02        ---------------------------------VGAFFASK
Q05KI8_BCL2L2-01        ---------------------------------VGAFFASK
Q1RMX3_BCL2L2-01        ---------------------------------VGAFFASK
Q45T69_BCL2L2-01        ---------------------------------VGAFFASK
A0A452ECF0_BCL2L2-      ---------------------------------VGAFFASK
A0A286XQQ9_BCL2L2-      ---------------------------------VGAFFASK
A0A2K5MZX9_BCL2L2-      ---------------------------------VGAFFASK
A0A0D9RU30_BCL2L2-      ---------------------------------VGAFFASK
A0A2K5HEK7_BCL2L2-      ---------------------------------VGAFFASK
F6PH48_BCL2L2-01        ---------------------------------VGAFFASK
A0A2I2UAE3_BCL2L2-      ---------------------------------VGAFFASK
A0A2I2YPX6_BCL2L2-      ---------------------------------VGAFFASK
I3ND50_BCL2L2-01        ---------------------------------VGAFFASK
A0A2K5V0Q3_BCL2L2-      ---------------------------------VGAFFASK
F7G4L5_BCL2L2-02        ---------------------------------VGAFFASK
F7G4L5_BCL2L2-03        ---------------------------------VGAFFASK
A0A2K6EA73_BCL2L2-      ---------------------------------VGAFFASK
A0A2K6AI30_BCL2L2-      ---------------------------------VGAFFASK
G1RYB4_BCL2L2-03        ---------------------------------VGAFFASK
A0A2R9A7B2_BCL2L2-      ---------------------------------VGAFFASK
H2Q805_BCL2L2-01        ---------------------------------VGAFFASK
A0A2I3MUE4_BCL2L2-      ---------------------------------VGAFFASK
A0A2K6GWN0_BCL2L2-      ---------------------------------VGAFFASK
A0A2K6MEE6_BCL2L2-      ---------------------------------VGAFFASK
A0A2K6RW46_BCL2L2-      ---------------------------------VGAFFASK
A0A2K6RW46_BCL2L2-      ---------------------------------VGAFFASK
A0A2K6TM77_BCL2L2-      ---------------------------------VGAFFASK
A0A287AW74_BCL2L2-      ---------------------------------VGAFFASK
A0A2U4CFE3_BCL2L2-      ---------------------------------VGAFFASK
A0A452SHI1_BCL2L2-      ---------------------------------VGAFFASK
A0A384DPS8_BCL2L2-      ---------------------------------VGAFFASK
F6U940_BCL2L2-01        ---------------------------------VGAFFASK
G3WPT2_BCL2L2-02        ---------------------------------VGAFFASK
W5QDH5_BCL2L2-02        ---------------------------------SGRFFAES
Q7TS60_BCL2L2-01        ---------------------------------VGAFFASK
G1LMC3_BCL2L2-01        ---------------------------------VGAFFASK
M3Y5X5_BCL2L2-01        ---------------------------------VGAFFASK
G1P3J2_BCL2L2-01        ---------------------------------VGAFFASK
I3ND50_BCL2L2-02        ---------------------------------WG------
P70345_BCL2L2-04        ----------------------------------G------
                                                                 

© 1998-2019