Dataset for protein Bcl2l10 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

70 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1QEX2_BCL2L10-01       --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       ------------------------------------------MSRGGVTH
A0A3Q2UUP0_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P8PVZ8_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q2UUP0_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P9BLI0_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3EZU5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------MFQLSWGLFLLEAESADK
A0A3P8W7K5_BCL2L10      --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
                                                                          

G1QEX2_BCL2L10-01       ----------------------------------DELKLRTRRLLTEFLE
F6VJQ0_BCL2L10-01       ------------------------------MDYKCALREETARLVTDYLE
A0A3Q4MN81_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3B4ETX9_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
D2IT42_BCL2L10-02       --------------------------------MSCRLWKETLALSEDYLL
A0A3Q0S9R1_BCL2L10      --------------------------------MVPGLWKETLGLAEDYLS
I3J363_BCL2L10-01       SLSAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLLLAEDYLS
A0A3Q2UUP0_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P8PVZ8_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2UUP0_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P9BLI0_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2PJS5_BCL2L10      -------------------MCREPSHIAGRKMS-CGLWKETVAVAEDYMR
A0A3Q2GL87_BCL2L10      -------------------MCREPLHITGRKMS-CGLWKETVAVAEDYMR
A0A3B5MJ12_BCL2L10      -------------------------------MS-CGLWKETVVVAEDYIR
M4AUW7_BCL2L10-01       -------------------------------MS-CGLWKETVVVAEDYIR
A0A096ME02_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3B3TYN4_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIR
A0A3B3YT99_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3P9NE65_BCL2L10      ---------MRRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3P9LM07_BCL2L10      -------------------------------MS-CGLRKETLAVALDYLS
H2MBQ3_BCL2L10-01       -------------------------------MS-CGLRKETLAVALDYLS
A0A3B4AAV4_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3Q3EZU5_BCL2L10      -------------------MCRAQSDIAGRKMS-CGLWKETLALAEDYLS
A0A3Q3EZU5_BCL2L10      -------------------MCRAQSDIAGRKMS-CGLWKETLALAEDYLS
A0A3Q3JQ78_BCL2L10      -------------------MCREHLDIAGRKMS-CGLWKDTLALAEDYLS
A0A3B4TIY6_BCL2L10      -------------------------------MS-CGLWKETRAVAEDYLY
A0A3B4WGF4_BCL2L10      -------------------------------MS-CGLWKETRAVAEDYLF
A0A3Q3KZW1_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3B5KD08_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3Q3VI28_BCL2L10      -------------------------------MS-CGLWKETLALAQDYLS
A0A3Q1GM98_BCL2L10      -------------------------------MS-CGLWKETVVLAEDYLS
A0A3Q1D2L0_BCL2L10      -------------------------------MS-CGLWKETLVLAEDYLS
A0A3P8RL82_BCL2L10      -------------------------------MS-CGLWKETLVLAEDYLS
A0A3B4ZFS0_BCL2L10      -------------------------------MS-CGLWKETLVVAEDYLS
A0A3B3C5I4_BCL2L10      -----------------------MDGFSAQKMS-CGLRKETLAVALDYLS
A0A3Q1IAB0_BCL2L10      CADAEGKLRVHRGSPSAVRMCREQTDIAGRKMS-CGLWKDTLALAEDYLS
A0A3P8W7K5_BCL2L10      --------MCNSASPSAVSTSSEQSDIAGRKMS-CGLWKETLAVAEDYLS
Q99M66_BCL2L10-01       --------------------------------MGDPLQDRTRRLLTDYIL
F6ZPD4_BCL2L10-01       --------------------------------VAEALRERTALLLIDYLQ
Q9Z0F3_BCL2L10-01       -----------------------------MADSQDPLHERTRRLLSDYIF
M3Y8D1_BCL2L10-01       ---MGVAAPPWAEAQRDLENRVGSGSAGRGRAMADALRERTAQLLTDYLE
E1B9B3_BCL2L10-01       --------------------------MTEGGAMVDPFRERTARLLMDYLE
F1RZB9_BCL2L10-01       --------------------------------MADAFRERTARLLTDYLE
G1T264_BCL2L10-01       -------------------------RPQRRLAMADALEERTARLLTDYLE
F1MV39_BCL2L10-01       -----------------------------VADGQESLVERTARLLMDYLE
W5QIG4_BCL2L10-01       -----------------------GRPPGRGGAMVDPFRERTARLLMDWLE
A0A2K6F2Q2_BCL2L10      --------------------------------MGDRFRERTERLLADYLE
H0WZ06_BCL2L10-01       --------------------------------MADPLRERTERLLTDYLE
A0A2K6TIT7_BCL2L10      --------------------------------MADPLQQRTEQLVADYLE
A0A2K5F974_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
F7CT87_BCL2L10-01       --------------------------------MADPLRQRTEQLVTDYLE
A0A0D9RG38_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A096NM44_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K6R5T5_BCL2L10      --------------------------------MADPLRERTERLLADYLG
Q9HD36_BCL2L10-02       ----------------------MVDQLRERTTMADPLRERTELLLADYLG
G1R3W6_BCL2L10-01       --------------------------------MVDQLRERTERLLADYLG
A0A2K5K3B0_BCL2L10      ----------------------MADQLRERTNVADPLRERTERLLADYLG
A0A2K6M5H5_BCL2L10      ----------------------MADPLRERTTVADPLRERTERLLADYLG
A0A2K5TKG9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
F7H6U5_BCL2L10-01       --------------------------------MADPLRERTERLLADYLG
A0A2K6B2D9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5MMZ4_BCL2L10      --------------------------------MADPLRERTERLLADYLG
H2NN92_BCL2L10-01       ----------------------MVDQLRERTITADLLRERTERLLADYLG
G3QLU6_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
A0A2R9BCD9_BCL2L10      ----------------------MVDQWRERTTMADPLRERTERLLADYLG
H2Q9G4_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
Q9HD36_BCL2L10-01       ----------------------MVDQLRERTTMADPLRERTELLLADYLG
A0A337RYG8_BCL2L10      --------------------------------MADALRERTAQLLTDYLE
G1LKR4_BCL2L10-01       --------------------------------MADALRG-TARLLTDYLE
A0A452QJG0_BCL2L10      --------------------------------MADALRERTARLLTDYLE
                                                            :   *  :  ::: 

G1QEX2_BCL2L10-01       HRTRRRGTAPQQPSTPEATVMRSLAAHSWLGTPHSWSR--------RQRN
F6VJQ0_BCL2L10-01       YCCRREGVQELPAPTPAAATLRLVSSELRQIYQDFFECALNQLLDREPEQ
A0A3Q4MN81_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3B4ETX9_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
D2IT42_BCL2L10-02       SCTAST-GTAPPPPSESAAAMRGLAQDMERQHYARFQALAQSFLAQCEAD
A0A3Q0S9R1_BCL2L10      LCCTSP-HQVPPPPSESAAAMRRLGQDIERQHQARFDNLAQTFLRHCGPD
I3J363_BCL2L10-01       FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3Q2UUP0_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3P8PVZ8_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3Q2UUP0_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3P9BLI0_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3Q2PJS5_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVESQHQARFHALAQSFLRHSQTD
A0A3Q2GL87_BCL2L10      LRCSSP-LPAPPPPSEPAAAMRRLAQDMETQHQARFHTLAQSFLRHSGTD
A0A3B5MJ12_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLKHCGSD
M4AUW7_BCL2L10-01       LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLKHCGSD
A0A096ME02_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3B3TYN4_BCL2L10      LCCSSP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3B3YT99_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3P9NE65_BCL2L10      LRCSNP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3P9LM07_BCL2L10      LSCRSP-LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPD
H2MBQ3_BCL2L10-01       LSCRSP-LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPD
A0A3B4AAV4_BCL2L10      LCCSGP-QAAPPPPSGSASAMRRLGQDMEAQHKARFHSLSQTFLKQCGPD
A0A3Q3EZU5_BCL2L10      LCCTSP-RPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLRQCGPD
A0A3Q3EZU5_BCL2L10      LCCTSP-RPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLRQCGPD
A0A3Q3JQ78_BCL2L10      LCCTSS-RPAPPPPSESAAAMRCLAQDMETQHQARFHSLAQTFLKQCGPD
A0A3B4TIY6_BCL2L10      LCCTSP-QPAPPPPSESAAAMRSMAQDMETQHQARFHTLAQTFVTQCGLD
A0A3B4WGF4_BCL2L10      LCCTSP-QPAPPPPSESAAAMRGMAQDMETQHQARFHTLAQTFVTQCGLD
A0A3Q3KZW1_BCL2L10      LCCTSP-QSVPPPPSESAAAMRCLAQKMERQHQARFHSLTQTFLKQCGPD
A0A3B5KD08_BCL2L10      LCSTSQ-CPAPPPPSESATAMRHLGQDMEKQHQARFNSLAQTFLRQCGPD
A0A3Q3VI28_BCL2L10      LCCTSQ-RPAPPPPSESAAAMRDLAQDMEKQHQARFHSLAQTFLRQCGTD
A0A3Q1GM98_BCL2L10      LCCAGP-HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQAFLRQCGPD
A0A3Q1D2L0_BCL2L10      LCCASP-HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQTFLRQCGPD
A0A3P8RL82_BCL2L10      LCCASP-HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQTFLRQCGPD
A0A3B4ZFS0_BCL2L10      LCCTSP-HSAPPPPSESAAAMRCLAQDMEKQHQARFHSLTQTFLRQPGPD
A0A3B3C5I4_BCL2L10      LSCRSPVLQAPPPPSESASAMRRLAQDMETQYQPRFSTLAQDFRKHCGPD
A0A3Q1IAB0_BCL2L10      LCCTSP-WPAPPPPSESAAAMRRLAQDMEKQHQVRFHSLAQTFLKQCGPD
A0A3P8W7K5_BCL2L10      LCCSSP-RPAPPPPSESAAAMRHLAQDMEKQHQARFQTLSQSFLRQCGSE
Q99M66_BCL2L10-01       FCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNS----FRDY-QGN
F6ZPD4_BCL2L10-01       RRAREPATP-------EVAVLRCVAAQIQPRNQRVLSR----YRGF-RGD
Q9Z0F3_BCL2L10-01       FCAREPDTPEPPPTSVEAALLRSVTRQIQQEHQEFFSS----FCES-RGN
M3Y8D1_BCL2L10-01       YCARGPGTPARSPSTREAAVLRSVAAVVRQRHERFLSD----YRGY-GGN
E1B9B3_BCL2L10-01       FCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRRC-RRH
F1RZB9_BCL2L10-01       YCAREPGTAARQPSSPEAAVLRCVAAQIREYNVRTLSV----YRGF-RWN
G1T264_BCL2L10-01       CCAREPGTPEPQPSTPEAAVLRCAATQLQRVHWPFFSV----YRGY-PGN
F1MV39_BCL2L10-01       FCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRRC-RRH
W5QIG4_BCL2L10-01       FCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPL----YRRY-RRH
A0A2K6F2Q2_BCL2L10      YCTREPGAPGLPPSSLEAAAMRFAATKIRRKHASFFSA----YVGY-PGN
H0WZ06_BCL2L10-01       YCARDPTAPEPTPSSPEAALLRSVTAYIQQRHWSFFSA----YIGY-PGN
A0A2K6TIT7_BCL2L10      YCSREPGTPESPPATAEAAVLRATAAVVRKLYPSFFSA----YRGY-PRN
A0A2K5F974_BCL2L10      YCSQEPGTPESPPSTAEAAVLRAMAAGVRKLYRSFFSA----YLGY-PGN
F7CT87_BCL2L10-01       YCSREPGTPESPPSTAEAAVLRAVAASVRKLYRSFFSA----YLGY-PGN
A0A0D9RG38_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A096NM44_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
A0A2K6R5T5_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
Q9HD36_BCL2L10-02       YCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
G1R3W6_BCL2L10-01       CCAREPGTPEPTPSTPEAAMLRSAAARLRQLHPSFFSA----YLGY-PGN
A0A2K5K3B0_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A2K6M5H5_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A2K5TKG9_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
F7H6U5_BCL2L10-01       CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
A0A2K6B2D9_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
A0A2K5MMZ4_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-RGN
H2NN92_BCL2L10-01       CCAREPGTPEPTPPTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
G3QLU6_BCL2L10-01       YCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
A0A2R9BCD9_BCL2L10      YCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
H2Q9G4_BCL2L10-01       YCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
Q9HD36_BCL2L10-01       YCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
A0A337RYG8_BCL2L10      YCAREPGSPARTPSTPEAAVLRYLAAQIRQRHQRFLSA----YRGY-RGN
G1LKR4_BCL2L10-01       YCAREPGTPARAPSTPEAAVLRSVAAQVQQRHERFLSD----YRGYAGGN
A0A452QJG0_BCL2L10      YCAREPGTPARAPSTPEAAVLRSVAAQVQQRHEHFLSD----YRGY-GGN
                                         .: :*                            

G1QEX2_BCL2L10-01       RLEQMVDQIESLVPDGTDPNWLSVVALVSFAGALLERPP----------P
F6VJQ0_BCL2L10-01       VIVNVAELM-----DRGEFNWGRVAVLVVFAGALLEMEE--LLKE-----
A0A3Q4MN81_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQK---P
A0A3B4ETX9_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQK---P
D2IT42_BCL2L10-02       ACAGLRKVMEELVGDGQ-LNWGRVVSLFTFTGVLARQ----LQEKKGVQL
A0A3Q0S9R1_BCL2L10      HCSSLRKVMEELVGDGH-LNWGRVVSLFAFTGVLARK----RLEQKP---
I3J363_BCL2L10-01       HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3Q2UUP0_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3P8PVZ8_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3Q2UUP0_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3P9BLI0_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3Q2PJS5_BCL2L10      LCTSLWKVMDEMVGDGH-FNWGRVVSLFTFAGVLARQ----LQEQQGRSP
A0A3Q2GL87_BCL2L10      LCSSLRKVMDEMVGDGL-FNWGRVVSLFTFAGVLARQ----LQEQTGKNP
A0A3B5MJ12_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
M4AUW7_BCL2L10-01       LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A096ME02_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3B3TYN4_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3B3YT99_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3P9NE65_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3P9LM07_BCL2L10      LCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQTDMNP
H2MBQ3_BCL2L10-01       LCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQTDMNP
A0A3B4AAV4_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSLFTFAGVLARH----IKEQKSSRP
A0A3Q3EZU5_BCL2L10      PCSGLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQEDVKL
A0A3Q3EZU5_BCL2L10      PCSGLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQEDVKL
A0A3Q3JQ78_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSLFAFTGVLARQ----LTEQNGMKP
A0A3B4TIY6_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSIFTFTGVLARL----LLEQNRVNP
A0A3B4WGF4_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSIFTFTGVLARL----LLEQNRVNP
A0A3Q3KZW1_BCL2L10      PCSSLRKVIEELVADGH-LNWGRVVSLFTFTGVLSRQ----LMEQKGMKP
A0A3B5KD08_BCL2L10      LCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARL----MQEQKSTKP
A0A3Q3VI28_BCL2L10      PCSSLRNVMEELVGDGH-LNWGRVVSIFTFTGVLARQ----LLEQKSTKP
A0A3Q1GM98_BCL2L10      FCSSLRMVMEELVEDGH-LNWGRVVSLFTFTGVLARQ----LLEQKDTKP
A0A3Q1D2L0_BCL2L10      LCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LLEQKDTKL
A0A3P8RL82_BCL2L10      LCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LLEQKDTKP
A0A3B4ZFS0_BCL2L10      LCSSLRRVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQRDTKP
A0A3B3C5I4_BCL2L10      LCSSLRKVMEELVGDEH-LNWGRVVSLFAFVGVLARQ----LREQTDTNP
A0A3Q1IAB0_BCL2L10      PCSSLRKVMEELVGDGH-MNWGRVVSLFTFTGVLARQ----MLEQKDKKP
A0A3P8W7K5_BCL2L10      PCVCLRKVMEELVGDGH-LNWGRVVSIFTFTGVLAKQ----LLVQKGLKP
Q99M66_BCL2L10-01       RLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDR-----------
F6ZPD4_BCL2L10-01       HVGLAARMAQAIFGDRHVPSWGRVAALVTLAGTLLERAP--RGTYRKPKR
Q9Z0F3_BCL2L10-01       RLELVKQMADKLLSKDQDFSWSQLVMLLAFAGTLMNQGP-----------
M3Y8D1_BCL2L10-01       RVELVAQLEREILAHPQALSWGRVVALVTFAGTLLERPPSGACSNLGPDP
E1B9B3_BCL2L10-01       RVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTTRR----
F1RZB9_BCL2L10-01       RVELVAWMAQKLLASPRGPNWYRVASLLTFAGMLLERHP--REAC-----
G1T264_BCL2L10-01       RIELAARVAEAVLSDGHDLSWGRVVTLVTFAGTLLDRGP--PVTT-----
F1MV39_BCL2L10-01       RVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTTR-----
W5QIG4_BCL2L10-01       RVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQP--QTTR-----
A0A2K6F2Q2_BCL2L10      RVYLLERMAEAVLCDS--LSWGRVVMLVTFAGTLLERGP--PVTAWWKKW
H0WZ06_BCL2L10-01       RVQVVERMVKAMLSDNQRLNWGRVVTLVTFAGTLLQRPP--VEARREKQD
A0A2K6TIT7_BCL2L10      RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
A0A2K5F974_BCL2L10      RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
F7CT87_BCL2L10-01       RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
A0A0D9RG38_BCL2L10      RVELVALMADAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LMTAWWKKQ
A0A096NM44_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K6R5T5_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
Q9HD36_BCL2L10-02       RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTARWKKW
G1R3W6_BCL2L10-01       RVELVVLMADSVLSDSPGPTWGRVVTLVAFAGTLLERGP--LVTARWKKW
A0A2K5K3B0_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K6M5H5_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K5TKG9_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
F7H6U5_BCL2L10-01       RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K6B2D9_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K5MMZ4_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
H2NN92_BCL2L10-01       RVELVALMADSVLSDSPSPTWGRVVTLVTFAGTLLERGP--LVTARWKKW
G3QLU6_BCL2L10-01       RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTARWKKW
A0A2R9BCD9_BCL2L10      RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTTRWKKW
H2Q9G4_BCL2L10-01       RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTTRWKKW
Q9HD36_BCL2L10-01       RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTARWKKW
A0A337RYG8_BCL2L10      RVELVARLEQDLLSNPQTLSWGHVVALLTFAGTLLERPP--PGTYLNLTP
G1LKR4_BCL2L10-01       RVELVAQVEREILAHPQPLSWGRVVALLTFAGTLLERSP--SGTYSNLGP
A0A452QJG0_BCL2L10      RVELVAQVEREILAHPQPLSWGRVVALLTFAGTLLERSP--SGTYSNLGP
                                           .*  :. :. :.* *                

G1QEX2_BCL2L10-01       GHSQ--ARREWDAT---VD-QDCQRLVTFLCSWLTE-THRTWMEAQGGW-
F6VJQ0_BCL2L10-01       ------EQVLQLRR------ETSRRLTEKLCNYLVE-RKGAWLHENGGW-
A0A3Q4MN81_BCL2L10      GLDP--GQQQELGQ---EP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-
A0A3B4ETX9_BCL2L10      GLDP--GQQQELGQ---EP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-
D2IT42_BCL2L10-02       GQDP--GTGRALGQ---VPGGSCRGLAETIADYLGE-EKRDWLLENGGW-
A0A3Q0S9R1_BCL2L10      GLDP--GQQQELGQ---EP-ISCRELAETIADYLGE-EKKDWLLDNDGW-
I3J363_BCL2L10-01       GLDP--GQQQELGQ---EP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-
A0A3Q2UUP0_BCL2L10      GLDP--RQQQELGQ---EP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-
A0A3P8PVZ8_BCL2L10      GLDP--RQQQELGQ---EP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-
A0A3Q2UUP0_BCL2L10      GLDP--RQQQELGQ---EP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-
A0A3P9BLI0_BCL2L10      GLDP--RQQQELGQ---EP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-
A0A3Q2PJS5_BCL2L10      GPDP--GRQQ-------EP-VSCRELAETIADYLEK-HKKDWLQENDGW-
A0A3Q2GL87_BCL2L10      GLDP--GRQQELQT---EP-VSCRALAETIADYLET-HKKDWLQENNGW-
A0A3B5MJ12_BCL2L10      VPDS--GKQQELQQ---EP-VSCRALAETIADYLEK-HKKDWLQENNGW-
M4AUW7_BCL2L10-01       VPDS--GKQQELQQ---EP-VSCRALAETIADYLEK-HKKDWLQENNGW-
A0A096ME02_BCL2L10      GPDS--GKQQELQQ---EP-VSCRALAETIADYLEK-HKKDWLQENNGW-
A0A3B3TYN4_BCL2L10      GPDS--GKQQELQQ---EP-VSCRALAETIADYLEK-HKKDWLQENNGW-
A0A3B3YT99_BCL2L10      GPDS--GKQQELQQ---EP-VSCRALAETIADYLEK-HKKDWLQENNGW-
A0A3P9NE65_BCL2L10      GPDS--GKQQELQQ---ET-VSCRALAETIADYLEK-HKKDWLQENNGW-
A0A3P9LM07_BCL2L10      GLDP----GREVAP---GP-VSCQALAETVADFLGG-DKKEWMLENDGW-
H2MBQ3_BCL2L10-01       GLDP----GREVAP---GP-VSCQALAETVADFLGG-DKKEWMLENDGW-
A0A3B4AAV4_BCL2L10      GLDP--GQVQGLGQ---VP-SDCRRLAQTIADYLGE-EKRDWLLENGGW-
A0A3Q3EZU5_BCL2L10      GLDP--VQGQKLGQ---GP-GHCRGLAETIADYLGE-EKKEWLLENDGW-
A0A3Q3EZU5_BCL2L10      GLDP--VQGQKLGQ---GP-GHCRGLAETIADYLGE-EKKEWLLENDGW-
A0A3Q3JQ78_BCL2L10      GLDP--GQGQELGQ---GP-GNCRELAETIADYLGE-EKKDWLLENDGW-
A0A3B4TIY6_BCL2L10      GLDP--GQGQGLG--------NCRGLAETIADYLGE-EKKDWLLENGGW-
A0A3B4WGF4_BCL2L10      GLDP--GQGQGLR--------NCRGLAETIADYLGE-EKKDWLLENGGW-
A0A3Q3KZW1_BCL2L10      GLDS--GKGQELGQ---GP-ESCRGLAETIADYLGE-EKKDWLQENDGW-
A0A3B5KD08_BCL2L10      GLDP--GQEQQLGQ---VP-ENCRGLAETIADYLGE-EKKDWLLENGGW-
A0A3Q3VI28_BCL2L10      GLEPRQDQDQELGQ---VP-GNCSELAETIADYLGE-EKKAWLLENDGW-
A0A3Q1GM98_BCL2L10      GLDP--GKRQELGQ---RP-VNCRGLAETIADYLGE-EKKDWLLENDGW-
A0A3Q1D2L0_BCL2L10      GLDP--GKQQELGQ---GP-VNCRELAETIADYLGE-EKKDWLLENDGW-
A0A3P8RL82_BCL2L10      GLDP--GKQQELGQ---GP-VNCRELAETIADYLGE-EKKDWLLENDGW-
A0A3B4ZFS0_BCL2L10      GLEP--GKRQELGQ---GP-VNCRGLAETIADYLGE-EKKDWLLENDGW-
A0A3B3C5I4_BCL2L10      GLDL----GREAAP---GP-VSCQALAETVADFLGG-DKKEWMLENDGW-
A0A3Q1IAB0_BCL2L10      GLDL--GKGQELGQ---EP-GQCRGLAETIADYLGE-EKKDWLLENDGW-
A0A3P8W7K5_BCL2L10      GQEP--EAGQELGP---EP-GTCRELAETIADYLGE-EKKAWLLENGGW-
Q99M66_BCL2L10-01       --TV--KRRRDQRNRLLLE-RDCYLIVSLLYNRLTG-RHRSWLEAHGGW-
F6ZPD4_BCL2L10-01       GYKL--ELREWKAG---VD-RD------WLRAWWTSCAHGSRGGTAPGWR
Q9Z0F3_BCL2L10-01       YMAV--KQKRDLGNRVIVT-RDCCLIVNFLYNLLMGRRHRARLEALGGW-
M3Y8D1_BCL2L10-01       ELEL--ELGEWEAS---VR-QDCRRLVDFLCGRLTG-QHRAWLEAHGGW-
E1B9B3_BCL2L10-01       ------QEKRDDDG---VS-RDCRLLVALLCAQFCE-RHRAWLMTNGGW-
F1RZB9_BCL2L10-01       ------GRKKKEGN---VS-RDCRLLVALLCAQLSG-QHRTWLLANGGW-
G1T264_BCL2L10-01       -------QRVRRNE---IA-RDCQRLVALLCARLAG-QHRAWLQAQGGW-
F1MV39_BCL2L10-01       ------RQKRDDDG---VS-RDCRLLVALLCAQFCE-RHRAWLMANGGW-
W5QIG4_BCL2L10-01       ------RQKRDDGS---VS-RDCRLLVALLCAQFCE-RHRAWLMANGGW-
A0A2K6F2Q2_BCL2L10      GLQP--QPKEGDPE---VA-RDRQRLVALLCARLAG-QHRAWLQAQGGW-
H0WZ06_BCL2L10-01       --KS--QLKEGEDE---VA-RDCQRLVALLSSRLVG-QHRVWLEAQGGW-
A0A2K6TIT7_BCL2L10      GFQS--RLKEPEGD---VA-RDCQRLVGLLSSRLVG-QHRAWLEAQGGW-
A0A2K5F974_BCL2L10      GFQS--RLKEPEGD---VA-RDCQRLVALLSSRLVG-QHRAWLEAQGGW-
F7CT87_BCL2L10-01       GFQS--RLKEPEGD---VA-RDCQRLVALLSSRLVG-QHRAWLEAQGGW-
A0A0D9RG38_BCL2L10      SFQP--RL-EQEGD---VA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-
A0A096NM44_BCL2L10      SFQP--RLKEQEGD---VA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-
A0A2K6R5T5_BCL2L10      SFQP--RLKEQEGE---VA-RDCQRLVALLSSRLTG-QHRAWLQAQGGW-
Q9HD36_BCL2L10-02       GFQP--RLKEQEGD---VA-RDCQRLVALLSSRLMG-QHRAWLQAQGGW-
G1R3W6_BCL2L10-01       GFQP--RLKEQEGD---VA-RDCQRLVALLSSRLVG-QHRAWLQAQGGW-
A0A2K5K3B0_BCL2L10      SFQP--RLKEQEGD---VA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-
A0A2K6M5H5_BCL2L10      SFQP--RLKEQEGD---VA-RDCQRLVALLSSRLTG-QHRAWLQAQGGW-
A0A2K5TKG9_BCL2L10      GFQP--RLKEQEGD---VA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-
F7H6U5_BCL2L10-01       GFQP--RLKEQEGD---VA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-
A0A2K6B2D9_BCL2L10      GFQP--RLKEQEGD---VA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-
A0A2K5MMZ4_BCL2L10      GFQP--RLKEQEGD---VA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-
H2NN92_BCL2L10-01       GFQP--RLKEQEGD---VA-RDCQRLVALLSSRLVG-QHRAWLQAQGGW-
G3QLU6_BCL2L10-01       GFQP--RLKEQEGD---VA-RDCQRLVALLSSRLMG-QHRAWLQAQGGW-
A0A2R9BCD9_BCL2L10      GFQP--RLKEQEGD---VA-RDCQRLVALLSSRLVG-QHRAWLQAQGGW-
H2Q9G4_BCL2L10-01       GFQP--RLNEQEGD---VA-RDCQRLVALLSSRLVG-QHRAWLQAQGGW-
Q9HD36_BCL2L10-01       GFQP--RLKEQEGD---VA-RDCQRLVALLSSRLMG-QHRAWLQAQGGW-
A0A337RYG8_BCL2L10      DQQQ--EL-EWETN---VG-QDCQHLVALLCNRLTG-RHRAWLEAHDGW-
G1LKR4_BCL2L10-01       DQEL--ELGEWEAG---VR-QDCRHLVDFLCNRLTG-QHRAWLEAHDGW-
A0A452QJG0_BCL2L10      DQEL--ELGEREAG---VR-QDCRHLVDFLCNRLTG-QHRAWLEAHDGW-
                                                     :        :  .     ** 

G1QEX2_BCL2L10-01       ---DG-----------------------FCHNF---MPAP------PPGD
F6VJQ0_BCL2L10-01       ---TG-----------------------FHHHFEKRQSPPPSDSSNNTLC
A0A3Q4MN81_BCL2L10      ---EG-----------------------FCKFS---RSAREVSQD-SSMK
A0A3B4ETX9_BCL2L10      ---EG-----------------------FCKFS---RSAREVSQD-SSMK
D2IT42_BCL2L10-02       ---EG-----------------------FCKFS---RIAREVNQE-SSMK
A0A3Q0S9R1_BCL2L10      ---EG-----------------------FCKYS---RSAREVSQD-SSMK
I3J363_BCL2L10-01       ---EG-----------------------FCKFS---RSAREVSQD-SSMK
A0A3Q2UUP0_BCL2L10      ---EG-----------------------FCKFS---RSAREVSQD-SSMK
A0A3P8PVZ8_BCL2L10      ---EG-----------------------FCKFS---RSAREVSQD-SSMK
A0A3Q2UUP0_BCL2L10      ---EG-----------------------FCKFS---RSAREVSQD-SSMK
A0A3P9BLI0_BCL2L10      ---EG-----------------------FCKFS---RSAREVSQD-SSMK
A0A3Q2PJS5_BCL2L10      ---DG-----------------------FCNYA---HGARGASQD-SSMK
A0A3Q2GL87_BCL2L10      ---DG-----------------------FCNYA---RNAREVSQD-SSMK
A0A3B5MJ12_BCL2L10      ---EG-----------------------FCSYA---RNAREASQD-SSMK
M4AUW7_BCL2L10-01       ---EG-----------------------FCSYA---RNAREASQD-SSMK
A0A096ME02_BCL2L10      ---DG-----------------------FCSYA---HNAREVSQD-SSMK
A0A3B3TYN4_BCL2L10      ---DG-----------------------FCSYA---HNAREVSQD-SSMK
A0A3B3YT99_BCL2L10      ---DG-----------------------FCSYA---HNAREVSQD-SSMK
A0A3P9NE65_BCL2L10      ---DG-----------------------FCSYA---LNAREVSQD-SSMK
A0A3P9LM07_BCL2L10      ---EG-----------------------FCKFS---RTAREVSQD-SSMK
H2MBQ3_BCL2L10-01       ---EG-----------------------FCKFS---RTAREVSQD-SSMK
A0A3B4AAV4_BCL2L10      ---VG-----------------------FCEFS---CHARKVDQD-SSMK
A0A3Q3EZU5_BCL2L10      ---EG-----------------------FCEFS---RSARETSQD-SSMK
A0A3Q3EZU5_BCL2L10      ---EG-----------------------FCEFS---RSARETSQD-SSMK
A0A3Q3JQ78_BCL2L10      ---EG-----------------------FCKFS---RSAREVSHD-SSVK
A0A3B4TIY6_BCL2L10      ---EG-----------------------FCKFS---HSAREVSQD-LSMK
A0A3B4WGF4_BCL2L10      ---EG-----------------------FCKFS---HSAREVSQD-LSMK
A0A3Q3KZW1_BCL2L10      ---EG-----------------------FCKFS---HSAREVSHD-SSMK
A0A3B5KD08_BCL2L10      ---EG-----------------------FCKYS---LAAREVNHD-SSMK
A0A3Q3VI28_BCL2L10      ---EG-----------------------FCKFS---HSAREARLD-SSMK
A0A3Q1GM98_BCL2L10      ---EG-----------------------FCKFS---LSARKASQD-LSMK
A0A3Q1D2L0_BCL2L10      ---EG-----------------------FCKFS---LSAREVSQD-LSMK
A0A3P8RL82_BCL2L10      ---EG-----------------------FCKFS---LSAREVSQD-LSMK
A0A3B4ZFS0_BCL2L10      ---EG-----------------------FVKFS---LSAREVSQD-LSMK
A0A3B3C5I4_BCL2L10      ---EG-----------------------FCKFS---RTAREVSQD-SSMK
A0A3Q1IAB0_BCL2L10      ---EG-----------------------FCKFS---CSAREVSQD-SSMK
A0A3P8W7K5_BCL2L10      ---EG-----------------------FCEFS---HSARELSQD-SSMK
Q99M66_BCL2L10-01       ---DG-----------------------FCQFF---KNPLPP----GFWR
F6ZPD4_BCL2L10-01       LTMDG-----------------------FCDFS---LTLP------ASQR
Q9Z0F3_BCL2L10-01       ---DG-----------------------FCRFF---KNPLPL----GFWR
M3Y8D1_BCL2L10-01       ---DG-----------------------FCLFF---TPAL------LSWK
E1B9B3_BCL2L10-01       --VSA------KDAGLVGSLGRAHAAGWILSLL---QPLIP-----AILG
F1RZB9_BCL2L10-01       ---DG-----------------------FCLFF---QGSLQ-----QTWT
G1T264_BCL2L10-01       ---DG-----------------------FCVFY---RTPLPL----TFWR
F1MV39_BCL2L10-01       ---DG-----------------------FCLFF---SQSFQ-----PSWE
W5QIG4_BCL2L10-01       ---DG-----------------------FCLSF---SHSLQ-----PSWE
A0A2K6F2Q2_BCL2L10      ---DG-----------------------FCDLF---RKPLPL----AVWR
H0WZ06_BCL2L10-01       ---DG-----------------------FCQFF---RTPLPL----AFWR
A0A2K6TIT7_BCL2L10      ---VS--TRRRTWGGMGTWEGPARWGIFLLCLL---NDLLLA----G-ME
A0A2K5F974_BCL2L10      ---VS--MRRGTRASRVAGNI--GW---LLLLL---QDLLLA----GIME
F7CT87_BCL2L10-01       ---VS--KEGDTGRDRHLGTARPRW---LLLLL---QDLLLA----GIME
A0A0D9RG38_BCL2L10      ---DG-----------------------FCHFF---RSPFPL----AFWR
A0A096NM44_BCL2L10      ---VSTRRTPGRGAGRASGKRPRGRHGWLLSLL---QEPLSA----GFLE
A0A2K6R5T5_BCL2L10      ---VSTRRTPGRGAGRASGKRPRGRHGWLLSLL---QDPLSA----GFLE
Q9HD36_BCL2L10-02       ---VSTRRTPGHGAGRAAGKRPRGWHGWLLSLL---QDPLST----GFLE
G1R3W6_BCL2L10-01       ---VSTRRTPGHGAGRAAGKRPRGRHGWLLSLL---QDPLSA----GFLE
A0A2K5K3B0_BCL2L10      ---DG-----------------------FCHFF---RTPFPL----AFWR
A0A2K6M5H5_BCL2L10      ---DG-----------------------FCHFF---RTPFPL----AFWR
A0A2K5TKG9_BCL2L10      ---DG-----------------------FCHFF---RSPFPL----AFWR
F7H6U5_BCL2L10-01       ---DG-----------------------FCHFF---RSPFPL----AFWR
A0A2K6B2D9_BCL2L10      ---DG-----------------------FCHFF---RSPFPL----AFWR
A0A2K5MMZ4_BCL2L10      ---DG-----------------------FCHFF---RSPFPL----AFWR
H2NN92_BCL2L10-01       ---DG-----------------------FCHFF---RTPLPL----AFWR
G3QLU6_BCL2L10-01       ---DG-----------------------FCHFF---RTPFPL----AFWR
A0A2R9BCD9_BCL2L10      ---DG-----------------------FCHFF---RTPFPL----AFWR
H2Q9G4_BCL2L10-01       ---DG-----------------------FCHFF---RTPFPL----AFWR
Q9HD36_BCL2L10-01       ---DG-----------------------FCHFF---RTPFPL----AFWR
A0A337RYG8_BCL2L10      ---DG-----------------------FCLFF---SPMLP-----SSWR
G1LKR4_BCL2L10-01       ---DG-----------------------FCLFF---TPMLP-----SSWK
A0A452QJG0_BCL2L10      --VNG-----------------------FCLFF---TPMLAVRLGKDCWP
                            .                       :                     

G1QEX2_BCL2L10-01       RLLAPLLRACLVLIILICLWIKIM--------------------------
F6VJQ0_BCL2L10-01       CIMAAAAGFGLVGLALLLVVR-----------------------------
A0A3Q4MN81_BCL2L10      KALFAAAGVGLAGLTFLLVR------------------------------
A0A3B4ETX9_BCL2L10      KALFAAAGVGLAGLTFLLVR------------------------------
D2IT42_BCL2L10-02       TALFAAAGVGIAGLTFLLVR------------------------------
A0A3Q0S9R1_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
I3J363_BCL2L10-01       KALFAAAGVGLAGLTFLLVKGFRF--------------------------
A0A3Q2UUP0_BCL2L10      KALFAAAGVGLAGLTFLL--------------------------------
A0A3P8PVZ8_BCL2L10      KALFAAAGVGLAGLTFLLVR------------------------------
A0A3Q2UUP0_BCL2L10      KALFAAAGVGLAGLTFLLVR------------------------------
A0A3P9BLI0_BCL2L10      KALFAAAGVGLAGLTFLLVR------------------------------
A0A3Q2PJS5_BCL2L10      TALVAVAGVGIAGLTFLLVR------------------------------
A0A3Q2GL87_BCL2L10      TALVAVAGVGIAGLTFLLVR------------------------------
A0A3B5MJ12_BCL2L10      TALVAVAGVGIAGLTFLLVR------------------------------
M4AUW7_BCL2L10-01       TALVAVAGVGIAGLTFLLVR------------------------------
A0A096ME02_BCL2L10      TALVAVAGVGIAGLTFLLVR------------------------------
A0A3B3TYN4_BCL2L10      TALVAVAGVGIAGLTFLLVR------------------------------
A0A3B3YT99_BCL2L10      TALVAVAGVGIAGLTFLLVR------------------------------
A0A3P9NE65_BCL2L10      TALVAVAGVGIAGLTFLLVR------------------------------
A0A3P9LM07_BCL2L10      TALFAAASVGLAGLTFLLVR------------------------------
H2MBQ3_BCL2L10-01       TALFAAASVGLAGLTFLLVR------------------------------
A0A3B4AAV4_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3Q3EZU5_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3Q3EZU5_BCL2L10      TALFAAAGVGLAGLTFLLIRVQA---------------------------
A0A3Q3JQ78_BCL2L10      TALFAAAGVGLAGLTFLLETSGTCEREQFRKSD-----------------
A0A3B4TIY6_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3B4WGF4_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3Q3KZW1_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3B5KD08_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3Q3VI28_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3Q1GM98_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3Q1D2L0_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3P8RL82_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3B4ZFS0_BCL2L10      TALFAAAGVGLAGLTFLLVR------------------------------
A0A3B3C5I4_BCL2L10      TALFAAASVGLAGLTFLLVR------------------------------
A0A3Q1IAB0_BCL2L10      RALFAAAGVGLAGLTFLLVR------------------------------
A0A3P8W7K5_BCL2L10      TALFAAASVGLAGLTFLLVR------------------------------
Q99M66_BCL2L10-01       RLLIRAILSCFFATAIFYIWKCL---------------------------
F6ZPD4_BCL2L10-01       ILLVRFLLSCFSASVLIYLWTKLS--------------------------
Q9Z0F3_BCL2L10-01       RLLIQAFLSGFFATAIFFIWKRL---------------------------
M3Y8D1_BCL2L10-01       RLLVQALLSCFTAVILIYFWKRLPFIG-----------------------
E1B9B3_BCL2L10-01       KTAGLVFPLILDSNNHNLLLDKIIVSSKILISTCLTLSNQAKLKCERPNQ
F1RZB9_BCL2L10-01       RHMVWVFVSYCTAVVLLYLWRKLL--------------------------
G1T264_BCL2L10-01       RLLVRTFLSCFVATALLFAWTRVY--------------------------
F1MV39_BCL2L10-01       RQLVWFFLAYWTAIIIIYFWIKLL--------------------------
W5QIG4_BCL2L10-01       RQLVWFFLSYWTAIIIIYFWIKLS--------------------------
A0A2K6F2Q2_BCL2L10      RLLVQVLLSCFLATTVIYFWTRLL--------------------------
H0WZ06_BCL2L10-01       RLLFEVLLLCFLATVFIYFWTRLT--------------------------
A0A2K6TIT7_BCL2L10      KTAGPGFPVMVVNSSIHLLLDTIIRSFKIFSPLLPAQL------------
A0A2K5F974_BCL2L10      KTAGPGFPVMVVNSSIHLLLDTIIRSF-----------------------
F7CT87_BCL2L10-01       KSAGPGFPVMVVNSSIHLLLDTIMRSFKSFSPLLPAQL------------
A0A0D9RG38_BCL2L10      KLLIQAFLACLLATAFGYLWTRLL--------------------------
A0A096NM44_BCL2L10      KTADPGFPGMLVSNSLRLSLDTIIMSFNIFNPLLPAQL------------
A0A2K6R5T5_BCL2L10      KTADPGFPGMLVNNSLRLPLDTIIMSFKIFNPLLPAQL------------
Q9HD36_BCL2L10-02       KTAGPGFSVMLVNNSLHLSLDTIIMSFKTFNPLLPAQL------------
G1R3W6_BCL2L10-01       KTAGPGFSVMLVNNSLHLFLDTIIMSFKTFNPLLPAQL------------
A0A2K5K3B0_BCL2L10      KLLIQAFLACLLTTAFGYLWTRLL--------------------------
A0A2K6M5H5_BCL2L10      KLLIQAFLACLLTTAFGYLWTRLL--------------------------
A0A2K5TKG9_BCL2L10      KLLIQAFLACLLATAFGYLWTRLL--------------------------
F7H6U5_BCL2L10-01       KLLIQAFLACLLATAFGYLWTRLL--------------------------
A0A2K6B2D9_BCL2L10      KLLIQAFLACLLATAFGYLWTRLL--------------------------
A0A2K5MMZ4_BCL2L10      TLLIQAFLACLLATAFGYLWTRLL--------------------------
H2NN92_BCL2L10-01       KQLVQAFLSCLLTTAFIYLWTRLL--------------------------
G3QLU6_BCL2L10-01       KQLVQAFLSCLLATAFIYLWTRLL--------------------------
A0A2R9BCD9_BCL2L10      KQLVQAFLSCLLTTAFIYLWTRLL--------------------------
H2Q9G4_BCL2L10-01       KQLVQAFLSCLLTTAFIYLWTRLL--------------------------
Q9HD36_BCL2L10-01       KQLVQAFLSCLLTTAFIYLWTRLL--------------------------
A0A337RYG8_BCL2L10      RLLVQALLSCFTVMILIYFWRRLL--------------------------
G1LKR4_BCL2L10-01       RLLAQALLSCFTAVILIYFWKRLL--------------------------
A0A452QJG0_BCL2L10      RLFCPA----SQAVILIYFWKRLCEF------------------------
                                                                          

G1QEX2_BCL2L10-01       -------------
F6VJQ0_BCL2L10-01       -------------
A0A3Q4MN81_BCL2L10      -------------
A0A3B4ETX9_BCL2L10      -------------
D2IT42_BCL2L10-02       -------------
A0A3Q0S9R1_BCL2L10      -------------
I3J363_BCL2L10-01       -------------
A0A3Q2UUP0_BCL2L10      -------------
A0A3P8PVZ8_BCL2L10      -------------
A0A3Q2UUP0_BCL2L10      -------------
A0A3P9BLI0_BCL2L10      -------------
A0A3Q2PJS5_BCL2L10      -------------
A0A3Q2GL87_BCL2L10      -------------
A0A3B5MJ12_BCL2L10      -------------
M4AUW7_BCL2L10-01       -------------
A0A096ME02_BCL2L10      -------------
A0A3B3TYN4_BCL2L10      -------------
A0A3B3YT99_BCL2L10      -------------
A0A3P9NE65_BCL2L10      -------------
A0A3P9LM07_BCL2L10      -------------
H2MBQ3_BCL2L10-01       -------------
A0A3B4AAV4_BCL2L10      -------------
A0A3Q3EZU5_BCL2L10      -------------
A0A3Q3EZU5_BCL2L10      -------------
A0A3Q3JQ78_BCL2L10      -------------
A0A3B4TIY6_BCL2L10      -------------
A0A3B4WGF4_BCL2L10      -------------
A0A3Q3KZW1_BCL2L10      -------------
A0A3B5KD08_BCL2L10      -------------
A0A3Q3VI28_BCL2L10      -------------
A0A3Q1GM98_BCL2L10      -------------
A0A3Q1D2L0_BCL2L10      -------------
A0A3P8RL82_BCL2L10      -------------
A0A3B4ZFS0_BCL2L10      -------------
A0A3B3C5I4_BCL2L10      -------------
A0A3Q1IAB0_BCL2L10      -------------
A0A3P8W7K5_BCL2L10      -------------
Q99M66_BCL2L10-01       -------------
F6ZPD4_BCL2L10-01       -------------
Q9Z0F3_BCL2L10-01       -------------
M3Y8D1_BCL2L10-01       -------------
E1B9B3_BCL2L10-01       SKPPSETFLSAFM
F1RZB9_BCL2L10-01       -------------
G1T264_BCL2L10-01       -------------
F1MV39_BCL2L10-01       -------------
W5QIG4_BCL2L10-01       -------------
A0A2K6F2Q2_BCL2L10      -------------
H0WZ06_BCL2L10-01       -------------
A0A2K6TIT7_BCL2L10      -------------
A0A2K5F974_BCL2L10      -------------
F7CT87_BCL2L10-01       -------------
A0A0D9RG38_BCL2L10      -------------
A0A096NM44_BCL2L10      -------------
A0A2K6R5T5_BCL2L10      -------------
Q9HD36_BCL2L10-02       -------------
G1R3W6_BCL2L10-01       -------------
A0A2K5K3B0_BCL2L10      -------------
A0A2K6M5H5_BCL2L10      -------------
A0A2K5TKG9_BCL2L10      -------------
F7H6U5_BCL2L10-01       -------------
A0A2K6B2D9_BCL2L10      -------------
A0A2K5MMZ4_BCL2L10      -------------
H2NN92_BCL2L10-01       -------------
G3QLU6_BCL2L10-01       -------------
A0A2R9BCD9_BCL2L10      -------------
H2Q9G4_BCL2L10-01       -------------
Q9HD36_BCL2L10-01       -------------
A0A337RYG8_BCL2L10      -------------
G1LKR4_BCL2L10-01       -------------
A0A452QJG0_BCL2L10      -------------
                                     

© 1998-2019