Dataset for protein Bcl-xL of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

200 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1GS47_BCL2L1-      MFRRHVKASYYVIGRQGRADVGGYVRAHTLVNTKWMCDILVELDSFLCAP
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
Q6GLI5_BCL2L1-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-02        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
A0A2U3V0P1_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-01        --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-02        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
G3RY91_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-03        --------------------------------------------------
Q64373_BCL2L1-04        --------------------------------------------------
P53563_BCL2L1-04        --------------------------------------------------
                                                                          

A0A3Q1GS47_BCL2L1-      SDRRTGDSVTERRTASRESRAFVSVLAGPELVCQPCVGLVFTPERPVDIS
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3B3ICL7_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
Q6GLI5_BCL2L1-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-02        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
A0A2U3V0P1_BCL2L1-      --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-01        --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-02        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
G3RY91_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
Q64373_BCL2L1-03        --------------------------------------------------
Q64373_BCL2L1-04        --------------------------------------------------
P53563_BCL2L1-04        --------------------------------------------------
                                                                          

A0A3Q1GS47_BCL2L1-      GPWWSEQRAAGRQPGTVCVHSNAARRTRATRTENTLARNMSQNRELVVFY
R4JQR8_BCL2L1-01        -------------------------------------MNQFSSRYLVADF
A0A346RRN1_BCL2L1-      -------------------------------------MNQYSSRYLVVDF
A0A452FIG6_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A452FIG6_BCL2L1-      --------------------------------------MSQSNRELVVDF
H3ANS8_BCL2L1-01        --------------------------------------KMSFNRLLVVDH
H0Z8G3_BCL2L1-01        --------------------------------------MYSSNRELVIDF
U3JSL7_BCL2L1-01        --------------------------------------MYSSNRELVIDF
Q4U2V6_BCL2L1-01        --------------------------------------MSSSNRELVIDF
A0A3B3ICL7_BCL2L1-      --------------------------------------MSHCNRELVRFY
A0A3B3E2W4_BCL2L1-      --------------------------------------MSHCNRELVQFY
A0A3B5B4X7_BCL2L1-      -----------------------------------MEIMSYSNRELVEFF
A0A3B4BFZ8_BCL2L1-      --------------------------------------MSPSNRELVEFF
A0A3Q3FUB6_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3B5MGS2_BCL2L1-      --------------------------------------MAYSNRELVEFY
M4A558_BCL2L1-01        --------------------------------------MAYSNRELVEFY
A0A3P9QFB3_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A087YBW4_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3B3VWI7_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3B3XN57_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3Q2C6K4_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A3Q2NRP4_BCL2L1-      --------------------------------------MSYSNRELVEFY
A0A0B4KJI5_BCL2L1-      --------------------------------------MSYSNRELVESF
A0A3Q1JZ46_BCL2L1-      -----------------------------------MEEMSNSNRELVEFF
A0A3Q1JZ46_BCL2L1-      -----------------------------------MEEMSNSNRELVEFF
A0A3Q3NFM4_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3Q3NFM4_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3B4V9K8_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3B4XS24_BCL2L1-      --------------------------------------MSYSNRELVEFF
C1BLI0_BCL2L1-01        --------------------------------------MSYSNRELVVFF
C0HAD8_BCL2L1-01        --------------------------------------MSYSNRELVVFF
A0A3B3ZN55_BCL2L1-      ---------------------------------------MSLNRELVEFY
A0A3B5K6B9_BCL2L1-      ---------------------------------------MSQNRELVIFY
A0A3B5K6B9_BCL2L1-      ---------------------------------------MSQNRELVIFY
H3CH49_BCL2L1-01        ------------------------RSHPGAKSKGASTQRMSLNRELVIFY
A0A3B3TFR4_BCL2L1-      --------------------------------------MSYSNRELVEYF
A0A3Q2FR43_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3P8XYL5_BCL2L1-      --------------------------------------MTYNNKELVAYY
Q90Z98_BCL2L1-02        --------------------------------------MSYYNRELVVFF
Q90Z98_BCL2L1-01        --------------------------------------MSYYNRELVVFF
A0A059PJI5_BCL2L1-      --------------------------------------MSYYNRELVVYF
A0A3B4DTL9_BCL2L1-      --------------------------------------MSYYNRELVVYF
B5XAY3_BCL2L1-01        -------------------------------------MMTYNNRELVVYY
W5MG74_BCL2L1-01        -------------------------------------KMSYSNRDLVVYY
A0A3Q3B3X5_BCL2L1-      ---------------------------------------MSQNKELVLFY
A0A3B3IB64_BCL2L1-      ---------------------------------------MSRNRELVVFY
A0A3P9JYH1_BCL2L1-      ---------------------------------------MSRNRELVVFY
A0A3B3DHA1_BCL2L1-      ---------------------------------------MSRNRELVVFY
A0A3Q0RTF8_BCL2L1-      ---------------------------------------MSQNRELVLFY
I3IZK7_BCL2L1-01        -------------------------------------YKMSQNRELVLFY
A0A2U9BY16_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A0D6DR75_BCL2L1-      ---------------------------------------MSQNRELVVYY
A0A3Q3WIW8_BCL2L1-      ---------------------------------------MSVNRELVAYY
A0A219P0Y3_BCL2L1-      ---------------------------------------MCQNRELVVCY
A0A3Q3MX20_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q3G2E1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q3G2E1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q3G2E1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1GZ93_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1GZ93_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1GZ93_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3B4V3T1_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3B4XU17_BCL2L1-      ---------------------------------------MSQNRELVVFY
D2ITA2_BCL2L1-02        --------------------------------MSIDTSMSISNRELVFFF
A0A3B3ICL7_BCL2L1-      -----------------------------------------MTKWKKSWH
A0A3B3QRZ2_BCL2L1-      --------------------------------------MSYSNRELVMDF
A0A3B3ZN55_BCL2L1-      ---------------------------------------MSLNRELVEFY
G3NJY1_BCL2L1-01        ---------------------------------------MSQNRELVVFY
A0A3Q3DUT7_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q3DUT7_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q3DUT7_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3B1JJ42_BCL2L1-      -------------------------------------VMSYYNRELVVYF
A0A3P8UWG7_BCL2L1-      ------------------------------------TLTFNINRKLVVDY
A0A3Q3IVF5_BCL2L1-      ---------------------------------------MSQNKELVVFY
A0A3Q1DHJ3_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1DHJ3_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1DHJ3_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3P8TL99_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3P8TL99_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3Q1GS47_BCL2L1-      ---------------------------------------MSQNRELVVFY
A0A3B4Z3X2_BCL2L1-      ---------------------------------------MSQNRELVVYY
A0A3B4Z3X2_BCL2L1-      ---------------------------------------MSQNRELVVYY
C3VIT1_BCL2L1-01        ---------------------------------------MSQNRELVVFY
A0A3P8P0F1_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q2X557_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3P9D632_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3P9D632_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q4N4B5_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3B4FNX1_BCL2L1-      ---------------------------------------MSQNRELVLFY
A0A3Q2QPL9_BCL2L1-      ---------------------------------------MSQNRELVLSY
A0A3B5PQJ0_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A087X9B7_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3B3TUS7_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3B3WI27_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3P9N9Y4_BCL2L1-      ---------------------------------------MSRNRELVLFY
A0A3Q3BEB7_BCL2L1-      --------------------------------------MSHSNRDLVQFY
A0A3P8VMA1_BCL2L1-      --------------------------------------MSCSNRELVKFF
A0A345BSW9_BCL2L1-      --------------------------------------MSYYNRELVVFF
A0A286MU87_BCL2L1-      --------------------------------------MSYSNRELVVFF
A0A3P8XFS0_BCL2L1-      --------------------------------------MSYSNRELVVFF
A0A3P8XFS0_BCL2L1-      --------------------------------------MSYSNRELVVFF
A0A0F7L1T6_BCL2L1-      --------------------------------------MSYNNRELVEHF
H2U5I3_BCL2L1-01        --------------------------------------MSYNNRELVEHF
H2U5I3_BCL2L1-02        --------------------------------------MSYNNRELVEHF
A0A3Q3J5K3_BCL2L1-      --------------------------------------MSYSHRELVEFY
A0A3Q1EVP6_BCL2L1-      --------------------------------------MSCSNRELVEFF
A0A3Q1BQA0_BCL2L1-      --------------------------------------MSYSNRELVEFF
A0A3P8U812_BCL2L1-      --------------------------------------MSYSNRELVEFF
E6ZFR0_BCL2L1-01        --------------------------------------MSYSNRELVEFF
G3P7B4_BCL2L1-01        --------------------------------------MANINRELVEFF
A0A3Q3X5M5_BCL2L1-      --------------------------------------MSHSNRELVEFF
A0A2U9BIG9_BCL2L1-      --------------------------------------MSDSNRELVEFF
Q6GLI5_BCL2L1-01        --------------------------------------MEGSSRDLVEKF
Q2TAP5_BCL2L1-01        --------------------------------------MEGSSRDLVEKF
Q91828_BCL2L1-01        --------------------------------------MEGSSRDLVEKF
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------MSSSNRALVVDF
Q07816_BCL2L1-04        --------------------------------------MSSSNRELVIDF
Q07817_BCL2L1-02        --------------------------------------MSQSNRELVVDF
A0A2K5YR37_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A452E1B1_BCL2L1-      --------------------------------------MSQSNRELVVDF
W5PSA5_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q07816_BCL2L1-01        --------------------------------------MSSSNRELVIDF
Q07816_BCL2L1-03        --------------------------------------MSSSNRELVIDF
Q07816_BCL2L1-02        --------------------------------------MSSSNRELVIDF
G1N5N5_BCL2L1-01        --------------------------------------MSSSNRELVIDF
A0A452ILL8_BCL2L1-      --------------------------------------MSNTNRELVIDF
A0A452ILL8_BCL2L1-      --------------------------------------MSNTNRELVIDF
K7F655_BCL2L1-01        --------------------------------------MSNTNRELVIDF
A0A287CZ07_BCL2L1-      --------------------------------------MSQSNRELVVDF
F6WA14_BCL2L1-01        --------------------------------------MSHSNRELVIDF
G3WKX6_BCL2L1-01        --------------------------------------MSHSNRELVVDF
F6WQI0_BCL2L1-02        --------------------------------------MSQSNRELVVDF
G3SPN0_BCL2L1-01        --------------------------------------MSQSNRELVVDF
H0X6V2_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q2PFS6_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------MSQSNRELVVDF
P53563_BCL2L1-03        --------------------------------------MSQSNRELVVDF
O35843_BCL2L1-01        --------------------------------------MSQSNRELVVDF
G1RER8_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q64373_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q64373_BCL2L1-09        --------------------------------------MSQSNRELVVDF
P53563_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2U3V0P1_BCL2L1-      --------------------------------------MSQSNRELVVDF
O77737_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q9MYW4_BCL2L1-01        --------------------------------------MSQSNRELVVDF
F6WQI0_BCL2L1-01        --------------------------------------MSQSNRELVVDF
B2Z3Z4_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q05KJ0_BCL2L1-02        --------------------------------------MSQSNRELVVDF
Q05KJ0_BCL2L1-01        --------------------------------------MSQSNRELVVDF
E2IV76_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K6G3C5_BCL2L1-      --------------------------------------MSQSNRELVVDF
M3Z2H9_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A0D9RJZ8_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A286Y5D6_BCL2L1-      --------------------------------------MSQSNWELVVDF
A0A1L5BWY3_BCL2L1-      --------------------------------------MSQSNRELVVDF
I3MUP5_BCL2L1-03        --------------------------------------MSQSNRELVVDF
I3MUP5_BCL2L1-01        --------------------------------------MSQSNRELVVDF
I3MUP5_BCL2L1-02        --------------------------------------MSQSNRELVVDF
G1P9D2_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K5EBP4_BCL2L1-      --------------------------------------MSQSNRELVVDF
E2IV75_BCL2L1-01        --------------------------------------MSQSNRELVVDF
F7IT34_BCL2L1-01        --------------------------------------MSQSNRELVVDF
F7IT34_BCL2L1-02        --------------------------------------MSQSNRELVVDF
Q76LT7_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K5M8B1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K5H963_BCL2L1-      --------------------------------------MSQSNRELVVDF
M3XA94_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q8SQ42_BCL2L1-01        --------------------------------------MSQSNRELVVDF
G3RY91_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q07817_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q07817_BCL2L1-03        --------------------------------------MSQSNRELVVDF
A0A2K5VPG2_BCL2L1-      --------------------------------------MSQSNRELVVDF
F6UKR4_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A2K5YR37_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2J8VIH3_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K6LPM4_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K6QFA2_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K6QFA2_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A2K6UWY8_BCL2L1-      --------------------------------------MSQSNRELVVDF
E2IV77_BCL2L1-01        --------------------------------------MSQSNRELVVDF
A0A452SDS4_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A384D3U1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A452FWV3_BCL2L1-      --------------------------------------MSQSNRELVVDF
Q9MZS7_BCL2L1-01        --------------------------------------MSQSNRELVVDF
Q64373_BCL2L1-03        --------------------------------------MSQSNRELVVDF
Q64373_BCL2L1-04        --------------------------------------MSQSNRELVVDF
P53563_BCL2L1-04        --------------------------------------MSQSNRELVVDF
                                                                          

A0A3Q1GS47_BCL2L1-      IKYKLSQRNYPLNHMV-LNEAPN----RTDGGEARLGEDQRTETH-----
R4JQR8_BCL2L1-01        INDRLRKHGMRWDNCPTLDLPPS---------------------------
A0A346RRN1_BCL2L1-      VNDRLRKNGLQWENCPSLEVPPS---------------------------
A0A452FIG6_BCL2L1-      LSYKLSQKGFSWSLRR---------------DKIRYGNPNAVNANPSWHL
A0A452FIG6_BCL2L1-      LSYKLSQKGFSWSLRR---------------DKIRYGNPNAVNANPSWHL
H3ANS8_BCL2L1-01        ISQKLMQRGYQWREVGEQDHGGG----GDRAREAQTPEEGAIPG----MD
H0Z8G3_BCL2L1-01        VSYKLSQKGYSWSQLE--EEDEN----RTDFAGEEDEMDGVLNGSPSWHA
U3JSL7_BCL2L1-01        VSYKLSQKGYSWSQLE--EEDEN----RTDFAGEEDEMDGVLNGSPSWHA
Q4U2V6_BCL2L1-01        VSYKLSQKGYSWSQLE--EEDEN----RTDFAGEEDEMDGVLNGSPSWHA
A0A3B3ICL7_BCL2L1-      LAYKMSCRDYPVSLLK-PTDDGG----ETEEDH---------------SD
A0A3B3E2W4_BCL2L1-      LGYKMSSRDYPVSLLK-PTDDGG----QTAEDR---------------SA
A0A3B5B4X7_BCL2L1-      ISYKLSQRNYPTSLLR-PEDAAG----RTEGDKTN-------------SA
A0A3B4BFZ8_BCL2L1-      ISYKLSQKNYPSSLLM-SDPARV----QCEGNKAA-------------NV
A0A3Q3FUB6_BCL2L1-      ISYKLSQRNYPTYVLR-SEDAGE----RTEGDMEN-------------SA
A0A3B5MGS2_BCL2L1-      ISYKLSQRNYSSSLLR-SEVAGG----RTNWEGDS-------------RV
M4A558_BCL2L1-01        ISYKLSQRNYSSSLLR-SEVAGG----RTNWEGDS-------------RV
A0A3P9QFB3_BCL2L1-      ISYKLSQRNYSSSLLR-SEADGA----RTNWDGDS-------------RG
A0A087YBW4_BCL2L1-      ISYKLSQRNYSSSLLR-SEADGA----RTNWDGDS-------------RG
A0A3B3VWI7_BCL2L1-      ISYKLSQRNYSSSLLR-SEADGA----RTNWDGDS-------------RG
A0A3B3XN57_BCL2L1-      ISYKLSQRNYSSSLLR-SEADGA----RTNWDGDS-------------RG
A0A3Q2C6K4_BCL2L1-      ISYKLSQTNCPNSLLR-SEVTGG----RTEGDKDA-------------SA
A0A3Q2NRP4_BCL2L1-      ISYKLSQTNCPNSLLR-SEVAGD----RTEGDKDS-------------PA
A0A0B4KJI5_BCL2L1-      LSYKLSQRNYPTALLR-PDDAGG----RTEADKAN-------------SA
A0A3Q1JZ46_BCL2L1-      IMYKLSQRNHPASLLR-PDDTGG------VGDRPN-------------SA
A0A3Q1JZ46_BCL2L1-      IMYKLSQRNHPASLLR-PDDTGG------VGDRPN-------------SA
A0A3Q3NFM4_BCL2L1-      ISYKLSQKNYPTSLLR-PEDAGG----RTEGDMTG-------------AA
A0A3Q3NFM4_BCL2L1-      ISYKLSQKNYPTSLLR-PEDAGG----RTEGDMTG-------------AA
A0A3B4V9K8_BCL2L1-      ISYKLSQSNCPTSLLR-PEDAGG----RTEGDKAN-------------SA
A0A3B4XS24_BCL2L1-      ISYKLSQSNCPTSLLR-PEDAGG----RTEGDKAS-------------SA
C1BLI0_BCL2L1-01        ISYKLSQRNYPISQLG-LEDASE----RTNVDKTN-------------VS
C0HAD8_BCL2L1-01        ISYRLSQRNYSCCQLG-LEGASG----RTEGDD----------------A
A0A3B3ZN55_BCL2L1-      IQYKLSQRDCPLGLED--------------GTEIDTERDRDL------LG
A0A3B5K6B9_BCL2L1-      IKYKLSQRNYPFNHNGLILEPPS----RTDGQFV--------------TT
A0A3B5K6B9_BCL2L1-      IKYKLSQRNYPFNHNGLILEPPS----RTDGQFV--------------TT
H3CH49_BCL2L1-01        IKYKLSQRNYPLSH---IVEPSS----RTEGQFG--------------TT
A0A3B3TFR4_BCL2L1-      VSYKLAQKNYSIAHII-QDEADE----QTGGGEGEAAGA---------VA
A0A3Q2FR43_BCL2L1-      IKFKLSQRNYPVNHIM-LNEPPN----GTGAQGAEQDDERTP------ET
A0A3P8XYL5_BCL2L1-      ITYKLSQRNYPINHTG-LTGAFD----RTEGGEVEEVAAV--------TM
Q90Z98_BCL2L1-02        IKYKLSQRNYPCNHIG-LTEDTN----RTDGAEENGEGAAGA------TT
Q90Z98_BCL2L1-01        IKYKLSQRNYPCNHIG-LTEDTN----RTDGAEENGEGAAGA------TT
A0A059PJI5_BCL2L1-      IKYKLSQKNYPCDHIG-LTEEVN--------GQVAEENAVGAGESETPTA
A0A3B4DTL9_BCL2L1-      IKYKLSQRNYPYNHIG-LMEDTN----RTEGGQAAEENAEGA--AVTPTA
B5XAY3_BCL2L1-01        ITYKLSQRDYPFNHME-LTEAQN----RTEVGQVE--GGAAV------LT
W5MG74_BCL2L1-01        INYKLSQKNYSWDQFS-LE---G----RTGGAEAVGSGSPNA------EE
A0A3Q3B3X5_BCL2L1-      IMYKLSQRNYPVNHII-LSDPPN----RTDAGDAGLEDAEMT------ET
A0A3B3IB64_BCL2L1-      VKYKLSQRNYPLNHIV-LNESPN----RTAAGEVG--EEQST------ET
A0A3P9JYH1_BCL2L1-      VKYKLSQRNYPLNHIV-LNESPN----RTAAGEVG--EEQST------ET
A0A3B3DHA1_BCL2L1-      VKYKLSQRNYPLNHIV-LNESPN----RTAAGEVG--EEQST------ET
A0A3Q0RTF8_BCL2L1-      ITYKLSQRNYPLNHIV-LNEPSN----RTDGGAAGLDEEQRI------DT
I3IZK7_BCL2L1-01        IRYKLSQRNYPLNHIV-LNEPLN----RTDGGAAGLDEEQRI------DT
A0A2U9BY16_BCL2L1-      IQYKLSQRKYPLNHMG-LNEPPN----RTDRGEAGLGEEQQT------AP
A0A0D6DR75_BCL2L1-      ITYKLSEKNYPLNHLG-LSEPPN----RTDGGEVESAEEQRI------AT
A0A3Q3WIW8_BCL2L1-      INYKLSHRGCPLNHMG-LIEPPN----RTEGGQAVSDEEQRV------AT
A0A219P0Y3_BCL2L1-      IKYKLTQRNYPLNHMG-LIEPPN----RTDGGEAGLGEEQRV------AT
A0A3Q3MX20_BCL2L1-      IKYKLSQRNYPLIYIE-LNEQQN----RTDGGEAESGEEQRI------AT
A0A3Q3G2E1_BCL2L1-      ITYKFSQRNYPLNHME-LLEPPN----RTDGAGAGSGEEQQV------AT
A0A3Q3G2E1_BCL2L1-      ITYKFSQRNYPLNHME-LLEPPN----RTDGAGAGSGEEQQV------AT
A0A3Q3G2E1_BCL2L1-      ITYKFSQRNYPLNHME-LLEPPN----RTDGAGAGSGEEQQV------AT
A0A3Q1GZ93_BCL2L1-      ITYKLSQRNYPLNHLG-LNETPN----RTDGGEDGLSEEQRI------AT
A0A3Q1GZ93_BCL2L1-      ITYKLSQRNYPLNHLG-LNETPN----RTDGGEDGLSEEQRI------AT
A0A3Q1GZ93_BCL2L1-      ITYKLSQRNYPLNHLG-LNETPN----RTDGGEDGLSEEQRI------AT
A0A3B4V3T1_BCL2L1-      IKHKLSQRNYPLTHME-LNESPN----RTDGGEAGLVEEQRI------AT
A0A3B4XU17_BCL2L1-      IKYKLSQRNYPLTHME-LNESPN----RTDGGEAGLVEEQRI------AT
D2ITA2_BCL2L1-02        LSHKLSQRNYRPIPFQ-PEGAGE----GTDE------------DKSNRIG
A0A3B3ICL7_BCL2L1-      LTYKMSCRDYPVSLLK-PTDDGG----ETEE------DHSDARNRRLVSS
A0A3B3QRZ2_BCL2L1-      ITYKLSQRNYN-GHFG-LPEDRG----RTEGSGQADGREGVM----VTAT
A0A3B3ZN55_BCL2L1-      IQYKLSQRDCPLQHLG-LGDRST----QSDTEHLGLGDRGVDRARLQRET
G3NJY1_BCL2L1-01        INYKLSQRNLPLNHIG-LSEPPN----RTGG-----GVEAGAAGGQRGAT
A0A3Q3DUT7_BCL2L1-      IRYKLSQKNYPLNHIG-LRQALN----RTDG-----REEASGEEEQRVQT
A0A3Q3DUT7_BCL2L1-      IRYKLSQKNYPLNHIG-LRQALN----RTDG-----REEASGEEEQRVQT
A0A3Q3DUT7_BCL2L1-      IRYKLSQKNYPLNHIG-LRQALN----RTDG-----REEASGEEEQRVQT
A0A3B1JJ42_BCL2L1-      IKYKLSQRNYPTNHIG-LMEETN----RTEG-----GQEAEG-NAEAAGV
A0A3P8UWG7_BCL2L1-      IQYKLSQRNFPVHHLG-LGDSPN----RTDG-----EEAGLG-AEQRTST
A0A3Q3IVF5_BCL2L1-      ITYKLSQKNYPLSHLG-LNESPN----RTDG-----EEA----------T
A0A3Q1DHJ3_BCL2L1-      IKYKLSQRNYPLNHMV-LNEAPS----RTDG-----GEARLG-EEQRTET
A0A3Q1DHJ3_BCL2L1-      IKYKLSQRNYPLNHMV-LNEAPS----RTDG-----GEARLG-EEQRTET
A0A3Q1DHJ3_BCL2L1-      IKYKLSQRNYPLNHMV-LNEAPS----RTDG-----GEARLG-EEQRTET
A0A3P8TL99_BCL2L1-      IKYKLSQRNYPLNHMV-LNEAPS----RTDG-----GEARLG-EEQRTET
A0A3P8TL99_BCL2L1-      IKYKLSQRNYPLNHMV-LNEAPS----RTDG-----GEARLG-EEQRTET
A0A3Q1GS47_BCL2L1-      IKYKLSQRNYPLNHMV-LNEAPN----RTDG-----GEARLG-EDQRTET
A0A3B4Z3X2_BCL2L1-      IKYKLSQRNYPLNHMV-LNEAPN----RTDG-----GEARLA-EEQRTET
A0A3B4Z3X2_BCL2L1-      IKYKLSQRNYPLNHMV-LNEAPN----RTDG-----GEARLA-EEQRTET
C3VIT1_BCL2L1-01        IKYKLSQRNYPLNHIV-LNEPPN----RTGA-----GDGGLG-EEQSTET
A0A3P8P0F1_BCL2L1-      IRYKLSQRNYPLNHIV-LNEPSN----RTDG-----GAAGLD-EEQRIDT
A0A3Q2X557_BCL2L1-      IRYKLSQRNYPLNHIV-LNEPSN----RTDG-----GAAGLD-EEQRIDT
A0A3P9D632_BCL2L1-      IRYKLSQRNYPLNHIV-LNEPSN----RTDG-----GAAGLD-EEQRIDT
A0A3P9D632_BCL2L1-      IRYKLSQRNYPLNHIV-LNEPSN----RTDG-----GAAGLD-EEQRIDT
A0A3Q4N4B5_BCL2L1-      IRYKLSQRNYPLNHIV-LNEPSN----RTDG-----GAAGLD-EEQRIDT
A0A3B4FNX1_BCL2L1-      IRYKLSQRNYPLNHIV-LNEPSN----RTDG-----GAAGLD-EEQRIDT
A0A3Q2QPL9_BCL2L1-      VKFKLSQRNYPVNHIM-LNEPPS----DGGA-----RDAESD-EEQTAET
A0A3B5PQJ0_BCL2L1-      IKFKLSQRNYPIQHIL-PNEPPD----GTAA-----GDVGMD-DEQTLET
A0A087X9B7_BCL2L1-      IKFKLSQRNYPIQHIL-PNEPPDSTAAGDAA-----GDAGMD-DEQTLET
A0A3B3TUS7_BCL2L1-      IKFKLSQRNYPIQHIL-PNEPPDSTAAGDAA-----GDAGMD-DEQTLET
A0A3B3WI27_BCL2L1-      IKFKLSQRNYPIQHIL-PNEPPDSTAAGDAA-----GDAGMD-DEQTLET
A0A3P9N9Y4_BCL2L1-      IKFKLSQRNYPIQHIL-PNEPPDSTAARDAA-----GDGGMD-DEQTLET
A0A3Q3BEB7_BCL2L1-      ISYKLSQRNCSKSLLM-PEVAGE----RTE--------------KASSAP
A0A3P8VMA1_BCL2L1-      LGYKLSQRNYPESLLM-LRIGGE----QREG------------EEVTTAS
A0A345BSW9_BCL2L1-      IKYKLSQRNYPCNHIG-LTEDTN----RTDG------------AEENGEG
A0A286MU87_BCL2L1-      ISYRLSQRNYSCCQLG-LEGASG----RTDG------------DEAIANG
A0A3P8XFS0_BCL2L1-      INYKLSQRNYSCCELE-LEGASG----RTEG------------EEATANG
A0A3P8XFS0_BCL2L1-      INYKLSQRNYSCCELE-LEGASG----RTEG------------EEATANG
A0A0F7L1T6_BCL2L1-      LRYKLSQRNYPSSLLR-PEDTDG----RTEG------------EKRSPAA
H2U5I3_BCL2L1-01        LRYKLSQRNYPTSLLR-PEDTDG----RTEG------------EKRSPGA
H2U5I3_BCL2L1-02        LRYKLSQRNYPTSLLR-PEDTDG----RTEG------------EKRSPGA
A0A3Q3J5K3_BCL2L1-      ISYKLSQRNYSTSLLR-PENAGG----RTEG------------DRTNPAT
A0A3Q1EVP6_BCL2L1-      ISYKLSQRNYPMSLLR-PEDAGG----RTDG------------DKASSAS
A0A3Q1BQA0_BCL2L1-      VSDKLSQRNYPTSLLR-PEDAGG----RTDG------------DKANSAS
A0A3P8U812_BCL2L1-      VSYKLSQRNYPTSLLR-PEDAEG----RTDG------------DKANSAS
E6ZFR0_BCL2L1-01        ISYKLSQRNHPTSLLR-PENAGE----RTEG------------DKANSAA
G3P7B4_BCL2L1-01        LSYKLSQKNHPTSLLR-PEDAGG----RTEG------------DKANSAS
A0A3Q3X5M5_BCL2L1-      ISYKLTQKNYPTSLLR-PEDTGG----RTEG------------DKASSAA
A0A2U9BIG9_BCL2L1-      IGYKLSQRNYPTSLLR-PEDAGG----RTEG------------DKANSAA
Q6GLI5_BCL2L1-01        VCKKLSQKGAC-GEFSSNSQPKG---VSNGSSE----GPGATQG------
Q2TAP5_BCL2L1-01        VSKKLSQNEAC-RKFSNNPQPNA---ISNGTSTSERPGEGATQG------
Q91828_BCL2L1-01        VSKKLSQNEAC-RKFSNNPNPMP---YLMEPSTSERPGEGATQG------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      LSYKLSQKGYSWSQFS-----------------VRYGNPQWISGNPSWHL
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
G3RY91_BCL2L1-02        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        LSYKLSQRGHSWHEIE-----ME---SGEEAMEPANETGNTLNGSPSWHP
Q07816_BCL2L1-04        VSYKLSQRGHCWSELEEEDENRT---D----TAAEAEMDSVLNGSPSWHP
Q07817_BCL2L1-02        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2K5YR37_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A452E1B1_BCL2L1-      LSYKFFQKGYSWSQFSDMEENRT---ETLEGTESDMETPSAISGNPSWHL
W5PSA5_BCL2L1-01        LSYKFFQKGYSWSQFSDMEENRT---ETLEGTESDMETPSAISGNPSWHL
Q07816_BCL2L1-01        VSYKLSQRGHCWSELEEEDENRT---DTAA----EAEMDSVLNGSPSWHP
Q07816_BCL2L1-03        VSYKLSQRGHCWSELEEEDENRT---DTAA----EAEMDSVLNGSPSWHP
Q07816_BCL2L1-02        VSYKLSQRGHCWSELEEEDENRT---DTAA----EAEMDSVLNGSPSWHP
G1N5N5_BCL2L1-01        VSYKLSQKGHCWSELEEEDENRT---DTAA----EAEMDSVLNGSPSWHP
A0A452ILL8_BCL2L1-      LSYKLSQRGYSWSRFEGEDEIRT---DSAE----EAEMASVPNGSPSWHP
A0A452ILL8_BCL2L1-      LSYKLSQRGYSWSRFEGEDEIRT---DSAE----EAEMASVPNGSPSWHP
K7F655_BCL2L1-01        LSYKLSQRGHSWSWFEGEDEIRT---EAAE----EAEMASVPNGSPSWHP
A0A287CZ07_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEVETPSAINGNPSWHL
F6WA14_BCL2L1-01        LSYKLSQKGYNWSQFED--ENRT---EVLEGA----EIPSTVNGSPSWHP
G3WKX6_BCL2L1-01        LSYKLSQKGYNWSQFED--ENRT---EASEGT----EIPSTVNGSPSWHP
F6WQI0_BCL2L1-02        LSYKLSQKGYNWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
G3SPN0_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---GASEGTESEMEIPSAINGNPSRHL
H0X6V2_BCL2L1-01        ISYKLSQKGYSWSQFSDVEENRT---EAPEGNESELETPSAINGNPSWHL
Q2PFS6_BCL2L1-01        -----------------------------------METPSAINGNPSWHL
P53563_BCL2L1-02        LSYKLSQKGYSWSQFSDVEENRT---EAPEETEPERETPSAINGNPSWHL
P53563_BCL2L1-03        LSYKLSQKGYSWSQFSDVEENRT---EAPEETEPERETPSAINGNPSWHL
O35843_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEETEAERETPSAINGNPSWHL
G1RER8_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
Q64373_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEETEAERETPSAINGNPSWHL
Q64373_BCL2L1-09        LSYKLSQKGYSWSQFSDVEENRT---EAPEETEAERETPSAINGNPSWHL
P53563_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEETEPERETPSAINGNPSWHL
A0A2U3V0P1_BCL2L1-      LSYKLSQKGYSWSQFSDVDENRT---EAPEGTESDMETPSAINGNPSWHL
O77737_BCL2L1-01        LSYKLSQKGYSWSQFTDVEENRT---EAPEGTESEAETPSAINGNPSWHL
Q9MYW4_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTGPEMETPSAINGNPAWHP
F6WQI0_BCL2L1-01        LSYKLSQKGYNWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
B2Z3Z4_BCL2L1-01        LSYKFSQKGYSWSQFSDVEENRT---EAPEGTESERETPSAINGNPSWHL
Q05KJ0_BCL2L1-02        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESDMETPSAINGNASWHL
Q05KJ0_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESDMETPSAINGNASWHL
E2IV76_BCL2L1-01        LSYKLSQKGYSWSQFIDAEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2K6G3C5_BCL2L1-      LSYKLSQKGYSWSQFIDAEENRT---EAPEATESEMETPSAINGNPSWHL
M3Z2H9_BCL2L1-01        LSYKLSQKGYSWSQFSDAEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A0D9RJZ8_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A286Y5D6_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EGPEGTESEMETPSAINGNPSWHL
A0A1L5BWY3_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGIESEVETPSAINGNPSWHL
I3MUP5_BCL2L1-03        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEVETPSAINGNPSWHL
I3MUP5_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEVETPSAINGNPSWHL
I3MUP5_BCL2L1-02        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEVETPSAINGNPSWHL
G1P9D2_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEVETPSAINGNPSWHL
A0A2K5EBP4_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTDSEMETPSAINGNPSWHL
E2IV75_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTDSEMETPSAINGNPSWHL
F7IT34_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTDSEMETPSAINGNPSWHL
F7IT34_BCL2L1-02        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTDSEMETPSAINGNPSWHL
Q76LT7_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2K5M8B1_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2K5H963_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
M3XA94_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
Q8SQ42_BCL2L1-01        LSYKLSQKGYSWSRFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
G3RY91_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
Q07817_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
Q07817_BCL2L1-03        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2K5VPG2_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
F6UKR4_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2K5YR37_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2J8VIH3_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2K6LPM4_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2K6QFA2_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2K6QFA2_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A2K6UWY8_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTDSEMETPSAINGNPAWHL
E2IV77_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTDSEMETPSAINGNPAWHL
A0A452SDS4_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A384D3U1_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESEMETPSAINGNPSWHL
A0A452FWV3_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESDMETPSAINGNPSWHL
Q9MZS7_BCL2L1-01        LSYKLSQKGYSWSQFSDVEENRT---EAPEGTESDMETPSAINGNPSWHL
Q64373_BCL2L1-03        LSYKLSQKGYSWSQFSDVEENRT---EAPEETEAERETPSAINGNPSWHL
Q64373_BCL2L1-04        LSYKLSQKGYSWSQFSDVEENRT---EAPEETEAERETPSAINGNPSWHL
P53563_BCL2L1-04        LSYKLSQKGYSWSQFSDVEENRT---EAPEETEPERETPSAINGNPSWHL
                                                                          

A0A3Q1GS47_BCL2L1-      -----ANGTFNGT------SPGTPPPSPRRLASTAT------MDAVKEAL
R4JQR8_BCL2L1-01        --------------------------------------------QIQLKL
A0A346RRN1_BCL2L1-      --------------------------------------------QVQLTL
A0A452FIG6_BCL2L1-      AHSPAVNGATGHTEESGP------------------------VATAQQAP
A0A452FIG6_BCL2L1-      AHSPAVNGATGHTEESGP------------------------VATAQQAP
H3ANS8_BCL2L1-01        P----PNGSHPHAGLNGAVNGLPAGSSSR---LEAQAVSG--PEAVKRTL
H0Z8G3_BCL2L1-01        A----TSHIVNGA---TVHQNSLEVHEIR----------R--AADVRQAL
U3JSL7_BCL2L1-01        P----TSHIVNGA---SVHQSSLEVHEIR----------R--AADVRQAL
Q4U2V6_BCL2L1-01        A----TSHIVNGA---TVHQSSLEVHEIR----------R--AADVRQAL
A0A3B3ICL7_BCL2L1-      A----RNRRLVSS---EDGRLRRSCPCCA----------S--MDAIKSTL
A0A3B3E2W4_BCL2L1-      T----CNGTLVNS---EDGQLKKSCPCCA----------S--MDAIKSTL
A0A3B5B4X7_BCL2L1-      A----SNGLLVNS--------------RG----------G--IEAVKAAL
A0A3B4BFZ8_BCL2L1-      P-----NGMLTNR-N-GNRQTLASLPPDD----------H--LDAIKTAL
A0A3Q3FUB6_BCL2L1-      A----SNGFLVNS-RNRAGQSVMSSSPHT----------D--IEAVKAAL
A0A3B5MGS2_BCL2L1-      P----RNGPLVNS---WAGHPGKPRGPPA----------G--VEVVKSVL
M4A558_BCL2L1-01        P----SNGRLVNS---RAGPPGKPRGPMA----------G--VEVVKSVL
A0A3P9QFB3_BCL2L1-      P----SNGPLVNS---RAGSRGKSQGPP--------------VEVVKSVL
A0A087YBW4_BCL2L1-      P----SNGPLVNS---WAGSPGKSRDPPT----------G--VKVVKLVL
A0A3B3VWI7_BCL2L1-      P----SNGPLVNS---WAGSPGKSRDPPT----------G--VKVVKLVL
A0A3B3XN57_BCL2L1-      P----SNGPLVNS---WAGSPGKSQDPPT----------G--VEVVKSVL
A0A3Q2C6K4_BCL2L1-      S----SNGPLFNS---RPSPPGKPRAPHG----------S--IEAVKSAL
A0A3Q2NRP4_BCL2L1-      S----SNGPLVSS---WAGSPWQPWAPHG----------R--AEAVKSAL
A0A0B4KJI5_BCL2L1-      A----TNGLLANS-SNGGGQPGAD------------------IEAVKAAL
A0A3Q1JZ46_BCL2L1-      A----ANGLPVS----RSGELGNSSPPCK----------S--MEAVKTAL
A0A3Q1JZ46_BCL2L1-      A----ANGLPVS----RSGELGNSSPPCK----------S--MEAVKTAL
A0A3Q3NFM4_BCL2L1-      A----TNGLLVNS-RYVSGRPGMSSSPHG----------G--VEAVKAAL
A0A3Q3NFM4_BCL2L1-      A----TNGLLVNS-RYVSGRPGMSSSPHG----------G--VEAVKAAL
A0A3B4V9K8_BCL2L1-      A----SNGLLVNS-SDRCGQPGTSSPPHG----------G--IEAVKSAL
A0A3B4XS24_BCL2L1-      A----SNGLLVNS-SDRCGQPGTSSPPHG----------G--IEAVKSAL
C1BLI0_BCL2L1-01        P----VNGSVEND-RNCIGSLGISSSPQG----------G--IEAVKAAL
C0HAD8_BCL2L1-01        I----ANGSVGNS-RS---NLAKPSSPQG----------G--MEPVKAAL
A0A3B3ZN55_BCL2L1-      L----GDRSVDRN--------STPSLRLR--------LDS--ASDSAPAL
A0A3B5K6B9_BCL2L1-      Q----FNGTFNGA---SPG--TPPATSLA---------TS--LDTVKEAL
A0A3B5K6B9_BCL2L1-      Q----FNGTFNGA---SPG--TPPATSLA---------TS--LDTVKEAL
H3CH49_BCL2L1-01        Q----SNGTFNGA---SPG--TPPAPSQH-----QQSLTS--LDAVKEAL
A0A3B3TFR4_BCL2L1-      H----ANGSVSSGNSVGQG--APLEGATP---------QG--LEAVKEAL
A0A3Q2FR43_BCL2L1-      H----ANGTFNGT---SPG--SP--------RRQQASTAA--MEAVKAAL
A0A3P8XYL5_BCL2L1-      H----PNGTMNGT--SPGT--PTQQSPPSSPRRTV----G--LDAVKEAL
Q90Z98_BCL2L1-02        L----VNGTMNRTNASSTG--TPPQSPASSPQRQTNGSGG--LDAVKEAL
Q90Z98_BCL2L1-01        L----VNGTMNRTNASSTG--TPPQSPASSPQRQTNGSGG--LDAVKEAL
A0A059PJI5_BCL2L1-      V----VNGTLNGT--GSAG--TPPRSPTLSPQRQVNGSAS--LEAVKEAL
A0A3B4DTL9_BCL2L1-      V----VNGSVNGT--SHG----PAGSPTSSPQRRSNGAGG--LDAVKEAL
B5XAY3_BCL2L1-01        Y----VNGTSPGT---PPPRQSPPSSPRR--------TAG--LDAVKEAL
W5MG74_BCL2L1-01        R----TNGAANGG---GGP--VSRQPPQG-------------IEAVQGAL
A0A3Q3B3X5_BCL2L1-      H----ANGTFNGT---SPG--TPPASPLR--QQPLPTTAN--MDKVKEAL
A0A3B3IB64_BCL2L1-      H----ANGTFNGT---TPG--TPPLSPLR--EQQLPSTTN--MDAVKEAL
A0A3P9JYH1_BCL2L1-      H----ANGTFNGT---TPG--TPPLSPLR--EQQLPSTTN--MDAVKEAL
A0A3B3DHA1_BCL2L1-      H----ANGTFNGT---SPG--TPPLSPLR--QQQLPSTTN--MDAVKEAL
A0A3Q0RTF8_BCL2L1-      H----ANGTFNGT---SPG--TPPASPQR--QQQPPSTTN--LDAVKEAL
I3IZK7_BCL2L1-01        H----ANGTFNGT---SPG--TPPASPQR--QQQPPSTTD--LDAVKEAL
A0A2U9BY16_BCL2L1-      H----ANGTLNGV---NPG--TPPESPLR--LQRLPSSPS--LDAVKEAL
A0A0D6DR75_BCL2L1-      H----ANGTFNGR---SPG--TPPASPLR--QQRLPSPTS--LDAVKEAL
A0A3Q3WIW8_BCL2L1-      H----ANGTFNGT---SPG--TPPRSPLR----LQPSTTS--LDAVKDAL
A0A219P0Y3_BCL2L1-      H----ANGTFNGM---SPG--TPPASPLR--QQQLPSTTS--LDAVKEAL
A0A3Q3MX20_BCL2L1-      H----ANGTFNGT---SPG--TPPASPLR--QEHLQSTAS--LDAVKEAL
A0A3Q3G2E1_BCL2L1-      H----ANGTFNGT---SPG--TPPASPHRQQQQRLPATTN--LDAVKEAL
A0A3Q3G2E1_BCL2L1-      H----ANGTFNGT---SPG--TPPASPHRQQQQRLPATTN--LDAVKEAL
A0A3Q3G2E1_BCL2L1-      H----ANGTFNGT---SPG--TPPASPHRQQQQRLPATTN--LDAVKEAL
A0A3Q1GZ93_BCL2L1-      H----ANGTFNGR---SPG--TPPASPLR--QQRLPSTTS--LDAVKEAL
A0A3Q1GZ93_BCL2L1-      H----ANGTFNGR---SPG--TPPASPLR--QQRLPSTTS--LDAVKEAL
A0A3Q1GZ93_BCL2L1-      H----ANGTFNGR---SPG--TPPASPLR--QQRLPSTTS--LDAVKEAL
A0A3B4V3T1_BCL2L1-      H----ANGTFNGT---SPG--TRAESPQR--QQRLPSTTS--LDAVKEAL
A0A3B4XU17_BCL2L1-      H----ANGTFNGT---SPG--TRPESPQR--QQRLPSTTS--LDAVKEAL
D2ITA2_BCL2L1-02        NNGLRLNDGNGNG---QLAPSPTPQG----------------TEAVRAAL
A0A3B3ICL7_BCL2L1-      EDGRLRRSCPCCA---S-------------------------MDAIKSTL
A0A3B3QRZ2_BCL2L1-      H----VNGSVIAG---GTSSQVSPVPEQPLHSPSPSPQG---LEAVKEAL
A0A3B3ZN55_BCL2L1-      E----VDSTELRL---DSASDSAPVHSPAPLLD---------LDAVKEAL
G3NJY1_BCL2L1-01        H----SNGTFNGT---S---PGTPPASPLLQQRSPSTAS---LDAVKEAL
A0A3Q3DUT7_BCL2L1-      P----ANGTTNGT---S------PPASPLREAAS--------LDAVKEAL
A0A3Q3DUT7_BCL2L1-      P----ANGTTNGT---S------PPASPLREAAS--------LDAVKEAL
A0A3Q3DUT7_BCL2L1-      P----ANGTTNGT---S------PPASPLREAAS--------LDAVKEAL
A0A3B1JJ42_BCL2L1-      TPTAVVNGSVNGT---SHGAAGSPTSSPQRRANGARG-----LDAVKEAL
A0A3P8UWG7_BCL2L1-      H----ANGTVNGT---S---SGTPPASPLRQQHSASDTS---LDSIKEAL
A0A3Q3IVF5_BCL2L1-      H----ANGTFNGT---S---PGTPPASPLRQQQLPSTAN---LDAVKEAL
A0A3Q1DHJ3_BCL2L1-      H----ANGTFNGT---S---PGTPPPSPRRLASTAT------MDAVKEAL
A0A3Q1DHJ3_BCL2L1-      H----ANGTFNGT---S---PGTPPPSPRRLASTAT------MDAVKEAL
A0A3Q1DHJ3_BCL2L1-      H----ANGTFNGT---S---PGTPPPSPRRLASTAT------MDAVKEAL
A0A3P8TL99_BCL2L1-      H----ANGTFNGT---S---PGTPPPSPRRLASTAT------MDAVKEAL
A0A3P8TL99_BCL2L1-      H----ANGTFNGT---S---PGTPPPSPRRLASTAT------MDAVKEAL
A0A3Q1GS47_BCL2L1-      H----ANGTFNGT---S---PGTPPPSPRRLASTAT------MDAVKEAL
A0A3B4Z3X2_BCL2L1-      H----ANGTFNGT---S---PGTPPPSPRRLASTAT------MDAVKEAL
A0A3B4Z3X2_BCL2L1-      H----ANGTFNGT---S---PGTPPPSPRRLASTAT------MDAVKEAL
C3VIT1_BCL2L1-01        H----ANGTFTGT---S---PGTPPVSPLRQQPLPSTTTTTRLDAVKEAL
A0A3P8P0F1_BCL2L1-      H----ANGTFNGT---S---PGTPPASPQRRQQQPPSTTD--LDAVKEAL
A0A3Q2X557_BCL2L1-      H----ANGTFNGT---S---PGTPPASPQRRQQQPPSTTD--LDAVKEAL
A0A3P9D632_BCL2L1-      H----ANGTFNGT---S---PGTPPASPQRRQQQPPSTTD--LDAVKEAL
A0A3P9D632_BCL2L1-      H----ANGTFNGT---S---PGTPPASPQRRQQQPPSTTD--LDAVKEAL
A0A3Q4N4B5_BCL2L1-      H----ANGTFNGT---S---PGTPPASPQRRQQQPPSTTD--LDAVKEAL
A0A3B4FNX1_BCL2L1-      H----ANGTFNGT---S---PGTPPASPQRRQQQPPSTTD--LDAVKEAL
A0A3Q2QPL9_BCL2L1-      H----ANGTVNGT---S---SGSPRRRQQQPASTAA------MEAVKVAL
A0A3B5PQJ0_BCL2L1-      H----ANGTFNGT---S---PGSPRR--HQAASAST------MDAVKVAL
A0A087X9B7_BCL2L1-      H----ANGTFNGT---S---PGSPRR--QQAASAAT------MDAVKVTL
A0A3B3TUS7_BCL2L1-      H----ANGTFNGT---S---PGSPRR--QQAASAAT------MDAVKVTL
A0A3B3WI27_BCL2L1-      H----ANGTFNGT---S---PGSPRR--QQAASAAT------MDAVKVTL
A0A3P9N9Y4_BCL2L1-      H----ANGTFNGT---S---PGSPRR--QQAASAST------MDAVKVTL
A0A3Q3BEB7_BCL2L1-      SNGLLVNSRDGQS-----------------GKKIWPRRSD--IEAVKSAL
A0A3P8VMA1_BCL2L1-      SNGVPQTPSAVLQ-----------------------HCSG--AEAVKAAL
A0A345BSW9_BCL2L1-      AAGTTTLVNGSMN-------RTPPQSPATSPQHQTNGSGG--LDAVKEAL
A0A286MU87_BCL2L1-      SVGNYR--NSRSN-------LAKPSSP----------QGG--MEPVKAAL
A0A3P8XFS0_BCL2L1-      SVGNGR--NSRRN-------LGKPSTP----------QGC--MEAVKAAL
A0A3P8XFS0_BCL2L1-      SVGNGR--NSRRN-------LGKPSTP----------QGC--MEAVKAAL
A0A0F7L1T6_BCL2L1-      SNGLLVRSRNRGG---------ASPSA----------GAG--IEAVNAAL
H2U5I3_BCL2L1-01        SNGLLVRSRNRGG---------ASPSA----------GAG--IEAVNAAL
H2U5I3_BCL2L1-02        SNGLLVRSRNRGG---------ASPSA----------GAG--IEAVNAAL
A0A3Q3J5K3_BCL2L1-      TNGLG-------------------------------------IEAVKAAL
A0A3Q1EVP6_BCL2L1-      SNGLLVN--NRDG-----------------------------IEAVKSTL
A0A3Q1BQA0_BCL2L1-      SNGLLVN--SRGG-----------------------------IEAVKSAL
A0A3P8U812_BCL2L1-      SNGLLVN--SRGG-----------------------------IEAVKSAL
E6ZFR0_BCL2L1-01        RNGLLASKNTSGQ-------PGTSSSS----------GAD--IEAVKAAL
G3P7B4_BCL2L1-01        VPGRGSSAGQPGM-------SSPPPPP----------SGD--TEAVKAAL
A0A3Q3X5M5_BCL2L1-      RNGLLVNSSSRGG---------LSPST----------GAD--MEAVKSAL
A0A2U9BIG9_BCL2L1-      SNGLLVDGGNRCG---QLGTDPLPPDG----------G----VGAVKEAL
Q6GLI5_BCL2L1-01        ----------------------IV------------------GEEVLQAL
Q2TAP5_BCL2L1-01        ----------------------IV------------------EEEVLQAL
Q91828_BCL2L1-01        ----------------------IV------------------EEEVLQAL
I7GKS6_BCL2L1-01        ------------------------------------------------MW
A0A2K5EBP4_BCL2L1-      ------------------------------------------------MW
A0A2K6UWY8_BCL2L1-      ------------------------------------------------MW
A0A3Q1LRT3_BCL2L1-      ADSPTVNGATGHSRSL-DARKMIP------------------MTTVKQAL
A0A2K5M8B1_BCL2L1-      ------------------------------------------------MW
A0A2K5H963_BCL2L1-      ------------------------------------------------MW
G3RY91_BCL2L1-02        ------------------------------------------------MW
A0A2K5VPG2_BCL2L1-      ------------------------------------------------MW
F6UKR4_BCL2L1-02        ------------------------------------------------MW
A0A2K5YR37_BCL2L1-      ------------------------------------------------MW
A0A2K6LPM4_BCL2L1-      ------------------------------------------------MW
A0A2K6QFA2_BCL2L1-      ------------------------------------------------MW
A0A2K6G3C5_BCL2L1-      ------------------------------------------------MQ
H9GHK7_BCL2L1-01        SPSHVINGASEHPELLEEEEEENP------------------RVDVSQTL
Q07816_BCL2L1-04        PAGHVVNGATVHRSSL-EVHEIVR------------------ASDVRQAL
Q07817_BCL2L1-02        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K5YR37_BCL2L1-      VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A452E1B1_BCL2L1-      ADSSVVNGATGHSRSL-DAGKMIP------------------TAVVKQAL
W5PSA5_BCL2L1-01        ADSPVVNGATGHSRSL-DTGKMIP------------------MAVVKQAL
Q07816_BCL2L1-01        PAGHVVNGATVHRSSL-EVHEIVR------------------ASDVRQAL
Q07816_BCL2L1-03        PAGHVVNGATVHRSSL-EVHEIVR------------------ASDVRQAL
Q07816_BCL2L1-02        PAGHVVNGATVHRSSL-EVHEIVR------------------ASDVRQAL
G1N5N5_BCL2L1-01        PAGHVVNGAAVHRSSL-EVHEIVR------------------ASDVRQTL
A0A452ILL8_BCL2L1-      GASHIVNGAAGHSNSL-EAHERVP------------------ATGVRQAL
A0A452ILL8_BCL2L1-      GASHIVNGAAGHSNSL-EAHERVP------------------ATGVRQAL
K7F655_BCL2L1-01        GASHVVNGAAGHSNSL-EAHERVP------------------AAEVRQAL
A0A287CZ07_BCL2L1-      ADSPAINGATGHSSSL-DAREVIP------------------MAAVKQAL
F6WA14_BCL2L1-01        ADSRAVSGATGHSSSL-DAHETIP------------------VAAVKQAL
G3WKX6_BCL2L1-01        ADSRAVSGATGHSSSL-DAHETIP------------------VAAVKQAL
F6WQI0_BCL2L1-02        ADSPTGNGATGHSSSL-DAREVIP------------------MAAVKQAL
G3SPN0_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
H0X6V2_BCL2L1-01        ADSPTVNGATGHSSSL-DAREVIP------------------MAAVKQAL
Q2PFS6_BCL2L1-01        VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
P53563_BCL2L1-02        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
P53563_BCL2L1-03        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
O35843_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
G1RER8_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
Q64373_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
Q64373_BCL2L1-09        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
P53563_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2U3V0P1_BCL2L1-      ADSPAVNVATGHSSSL-DAREVIP------------------MAAVKQAL
O77737_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
Q9MYW4_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MTAVKQAL
F6WQI0_BCL2L1-01        ADSPTGNGATGHSSSL-DAREVIP------------------MAAVKQAL
B2Z3Z4_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
Q05KJ0_BCL2L1-02        ADSPAVNGATGHSRSS-DAREVIP------------------MAAVKQAL
Q05KJ0_BCL2L1-01        ADSPAVNGATGHSRSS-DAREVIP------------------MAAVKQAL
E2IV76_BCL2L1-01        ADSPPANGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K6G3C5_BCL2L1-      ADSPPANGATGHSSSL-DAREVIP------------------MAAVKQAL
M3Z2H9_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A0D9RJZ8_BCL2L1-      VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQTL
A0A286Y5D6_BCL2L1-      TDSPTVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A1L5BWY3_BCL2L1-      VDSPAVNGATGHSSSL-DAREVIP------------------MTAVKQAL
I3MUP5_BCL2L1-03        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
I3MUP5_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
I3MUP5_BCL2L1-02        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
G1P9D2_BCL2L1-01        VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K5EBP4_BCL2L1-      ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
E2IV75_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
F7IT34_BCL2L1-01        ADSPVVNGATGHSSSL-DAREVIP------------------MAAVKQAL
F7IT34_BCL2L1-02        ADSPVVNGATGHSSSL-DAREVIP------------------MAAVKQAL
Q76LT7_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K5M8B1_BCL2L1-      VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K5H963_BCL2L1-      VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
M3XA94_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
Q8SQ42_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
G3RY91_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
Q07817_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
Q07817_BCL2L1-03        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K5VPG2_BCL2L1-      VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
F6UKR4_BCL2L1-01        VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K5YR37_BCL2L1-      VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2J8VIH3_BCL2L1-      ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K6LPM4_BCL2L1-      VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K6QFA2_BCL2L1-      VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K6QFA2_BCL2L1-      VDSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A2K6UWY8_BCL2L1-      ADSPAVNGATGHSSSL-DAREVIP------------------MAAIKQAL
E2IV77_BCL2L1-01        ADSPAVNGATGHSSSL-DAREVIP------------------MAAIKQAL
A0A452SDS4_BCL2L1-      ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A384D3U1_BCL2L1-      ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
A0A452FWV3_BCL2L1-      ADSPAVNGATGHSRSL-DAREVIP------------------MAAVKQAL
Q9MZS7_BCL2L1-01        ADSPAVNGATGHSRSL-DAREVIP------------------MAAVKQAL
Q64373_BCL2L1-03        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
Q64373_BCL2L1-04        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
P53563_BCL2L1-04        ADSPAVNGATGHSSSL-DAREVIP------------------MAAVKQAL
                                                                          

A0A3Q1GS47_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
R4JQR8_BCL2L1-01        RSLGDEFQERFQTQFDDMVNQLHI---TEATAYPTFQRVVQELFIDGNIN
A0A346RRN1_BCL2L1-      RTIGDEFQERFRTQFDDMVDQLHI---TEATAYPTFQRVVQELFIDGNIN
A0A452FIG6_BCL2L1-      REAGSEFELRHQQTVSDLTSQLHT---TPGTAYQSFEQVMYELFWDG-VN
A0A452FIG6_BCL2L1-      REAGSEFELRHQQTVSDLTSQLHT---TPGTAYQSFEQVMYELFWDG-VN
H3ANS8_BCL2L1-01        REAGEEFELRYSRAFSDLSSQLHI---TPGTAYQSFEQVVNELFRDG-VN
H0Z8G3_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPSTAYQSFEQVVNELFRDG-VN
U3JSL7_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPSTAYQSFEQVVNELFRDG-VN
Q4U2V6_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPSTAYQSFEQVVNELFRDG-VN
A0A3B3ICL7_BCL2L1-      KDSADEFERRFHQGFSDLSVQLHI---TPDTAYQNFKRVLDELFKDG-IN
A0A3B3E2W4_BCL2L1-      KDSANEFERRFSQGFSDLSLQFHI---TPDTAYQNFKSVLDELFKDG-IN
A0A3B5B4X7_BCL2L1-      KDSADEFELLFTQAFSDLSSQLDI---TPDTAYHSFKSVMDEVFKDG-VN
A0A3B4BFZ8_BCL2L1-      TDSADEFEELFTQAFSNLSSQLDI---TPDTAYNSFKSVMDEVFKDG-VN
A0A3Q3FUB6_BCL2L1-      LDSADEFELLFTQAFSDLSSQLDI---TPNTAYHSFKSVMDEVFKDG-VN
A0A3B5MGS2_BCL2L1-      KDAAEEFERLYTQSFKHLSLQLDI---TPDTAYHSFKTVLDELFKGG-VN
M4A558_BCL2L1-01        KDAAEEFERLYTQSFKHLSLQLDI---TPDTAYHSFKTVLDELFKGG-VN
A0A3P9QFB3_BCL2L1-      KDAAEEFERLYTQSFKHLSLQLDI---TPDTAYHSFKTVLDELFKGE-VN
A0A087YBW4_BCL2L1-      KDAAEEFERLYTQSFKHLSLQLDI---TPDTAYQSFKTVLDELFKGE-VN
A0A3B3VWI7_BCL2L1-      KDAAEEFERLYTQSFKHLSLQLDI---TPDTAYQSFKTVLDELFKGE-VN
A0A3B3XN57_BCL2L1-      KDAAEEFERLYTQSFKHLSLQLDI---TPDTAYQSFKTVLDELFKGE-VN
A0A3Q2C6K4_BCL2L1-      KDSANEFELLFSQSFSDLSMQLDI---TPDTAYHSFKAVLDELFKDG-IN
A0A3Q2NRP4_BCL2L1-      RDSADEFEHLFTQSFSHLSLQLDI---TPDTAYHSFKAVLDELFKDG-VN
A0A0B4KJI5_BCL2L1-      RDSSEEFELLFTQAFSDLSTQLDI---TPDTAYHSFKSVMDEVFKDG-VN
A0A3Q1JZ46_BCL2L1-      RDSADEFELLFTQAFSDLSSQLDV---TPDTAYQSFKSVMDELFKDG-VN
A0A3Q1JZ46_BCL2L1-      RDSADEFELLFTQAFSDLSSQLDV---TPDTAYQSFKSVMDELFKDG-VN
A0A3Q3NFM4_BCL2L1-      RDSAEEFELLFTQAFSDLSSQLDI---TPDTAYHSFKSVMDEVFKDG-VN
A0A3Q3NFM4_BCL2L1-      RDSAEEFELLFTQAFSDLSSQLDI---TPDTAYHSFKSVMDEVFKDG-VN
A0A3B4V9K8_BCL2L1-      KDSADEFELLFNQAFSDLSTQLDI---TPDTAYHSFKSVMDELFKDG-VN
A0A3B4XS24_BCL2L1-      KDSADEFELLFNQAFSDLSTQLDI---TPDTAYHSFKSVMDELFKDG-VN
C1BLI0_BCL2L1-01        RDSADEFELRYTRAFNDPSSQLHI---TPATAYHSFESVMNEVFRDG-VN
C0HAD8_BCL2L1-01        RDSVDEFELRYTRAFSDLSSQLHI---TPATAYHSFESVMDEVFRDG-VN
A0A3B3ZN55_BCL2L1-      RDSANEFELRFSRAFSDLHRQLHI---TPATAYQSFESVMDEVFRDG-VN
A0A3B5K6B9_BCL2L1-      RDTGNEFELRYTCAFSDLHNQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3B5K6B9_BCL2L1-      RDTGNEFELRYTCAFSDLHNQLHI---TPATAYQSFENVMDEVFRDG-VN
H3CH49_BCL2L1-01        RDTGNEFELRYTCAFSDLHNQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3B3TFR4_BCL2L1-      RLSANEFEFRYQRAFSDLSSQLHI---TPATAYQSFESVMNEVFRDG-VN
A0A3Q2FR43_BCL2L1-      RDTACEFELRYARAFNDLHSTLHI---TPATAYQSFENVMNEVFRDG-VN
A0A3P8XYL5_BCL2L1-      RDSANEFELRYALAFSDLSSQLHL---TPATAYQSFASVMDEVFRDG-VN
Q90Z98_BCL2L1-02        RDSANEFELRYSRAFNDLSSQLHI---TPATAYQSFESVMDEVFRDG-VN
Q90Z98_BCL2L1-01        RDSANEFELRYSRAFNDLSSQLHI---TPATAYQSFESVMDEVFRDG-VN
A0A059PJI5_BCL2L1-      RDSGNEFELRYSRAFSDLSSQLHI---TPVTVYQSFESVMDEVFRDG-VN
A0A3B4DTL9_BCL2L1-      RDSANEFELRYSRAFSDLSSQLHI---TPATAYQSFESVMDEVFRDG-VN
B5XAY3_BCL2L1-01        RDSANEFELRYARAFSDLSSQLHI---TPSTAYQSFENVMDEVFRDG-VN
W5MG74_BCL2L1-01        RDSANEFELRYGRAFSDLSSQLHI---TPATAYQSFEHVMDEVFRDG-VN
A0A3Q3B3X5_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPGTVYQSFENVMDEVFRDG-VN
A0A3B3IB64_BCL2L1-      RDTANEFELRYALAFNNLHSQLHI---TPATAYQSFENVMNELFRDN-IN
A0A3P9JYH1_BCL2L1-      RDTANEFELRYALAFNNLHSQLHI---TPATAYQSFENVMNELFRDN-IN
A0A3B3DHA1_BCL2L1-      RDTANEFELRYALAFNNLHSQLHI---TPATAYQSFENVMNELFRDN-IN
A0A3Q0RTF8_BCL2L1-      RDTANEFELRYARAFNDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
I3IZK7_BCL2L1-01        RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A2U9BY16_BCL2L1-      RDSANEFELRYARAFSDLHNQLHI---TPATAYQSFESVMNEVFRDG-VN
A0A0D6DR75_BCL2L1-      RDSANEFELRYARAFSDLHNQLHI---TPATAYQSFANVMDEVFRDG-VN
A0A3Q3WIW8_BCL2L1-      RDSANEFELRYARAFSDLHNQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A219P0Y3_BCL2L1-      RDSANEFELRYARAFSDLHHQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q3MX20_BCL2L1-      RDSANEFELRYARAFSDLHNQLHI---TPATAYQSFESVMDEVFRDG-VN
A0A3Q3G2E1_BCL2L1-      RDSANEFELRYASAFSDLHNQLHI---TPATTHQSFENVMDEVFRDG-VN
A0A3Q3G2E1_BCL2L1-      RDSANEFELRYASAFSDLHNQLHI---TPATTHQSFENVMDEVFRDG-VN
A0A3Q3G2E1_BCL2L1-      RDSANEFELRYASAFSDLHNQLHI---TPATTHQSFENVMDEVFRDG-VN
A0A3Q1GZ93_BCL2L1-      RDSANEFELRYARAFSDLHNQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q1GZ93_BCL2L1-      RDSANEFELRYARAFSDLHNQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q1GZ93_BCL2L1-      RDSANEFELRYARAFSDLHNQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3B4V3T1_BCL2L1-      RDSANEFELRYSRAFSDLHNQLHI---TPATAYQSFANVMDEVFRDG-FN
A0A3B4XU17_BCL2L1-      RDSANEFELRYSRAFSDLHNQLHI---TPATAYQSFANVMDEVFRDG-FN
D2ITA2_BCL2L1-02        LESVEEFELRYTLAFSDLSSQLPI---TPATAYGSFESVMDEVFRDS-IN
A0A3B3ICL7_BCL2L1-      KDSADEFERRFHQGFSDLSVQLHI---TPDTAYQNFKRVLDELFKDG-IN
A0A3B3QRZ2_BCL2L1-      RDSANEFELRYSRAFSDLSSQLHI---TPVTAYQSFESVMNEVFRDG-IN
A0A3B3ZN55_BCL2L1-      RDSANEFELRFSRAFSDLHRQLHI---TPATAYQSFESVMDEVFRDG-VN
G3NJY1_BCL2L1-01        RDSANEFELRYARAFSDLHNQLHI---TPATAYQSFEDVMDEVFRDG-VN
A0A3Q3DUT7_BCL2L1-      RDSANEFELRYSHAFSDLDKQLHI---TPATAYQSFENVVDEVFQDD-VN
A0A3Q3DUT7_BCL2L1-      RDSANEFELRYSHAFSDLDKQLHI---TPATAYQSFENVVDEVFQDD-VN
A0A3Q3DUT7_BCL2L1-      RDSANEFELRYSHAFSDLDKQLHI---TPATAYQSFENVVDEVFQDD-VN
A0A3B1JJ42_BCL2L1-      RDSANEFELRYSRAFSDLSSQLHI---TPATAYQSFESVMDEVFRDG-VN
A0A3P8UWG7_BCL2L1-      RDSANEFELRYARAFSDLHQQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q3IVF5_BCL2L1-      RDSANEFELRYARAFSDLHHQLHI---TPATAYQSFESVMDEVFRDG-VN
A0A3Q1DHJ3_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q1DHJ3_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q1DHJ3_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3P8TL99_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3P8TL99_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q1GS47_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3B4Z3X2_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3B4Z3X2_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
C3VIT1_BCL2L1-01        RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3P8P0F1_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q2X557_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3P9D632_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3P9D632_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q4N4B5_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3B4FNX1_BCL2L1-      RDTANEFELRYARAFSDLHSQLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q2QPL9_BCL2L1-      RETACEFELRYARAFNDLHSTLHI---TPATAYQSFENVMNEVFRDG-VN
A0A3B5PQJ0_BCL2L1-      RDTAREFELRYSRAFNDLHSTLHI---TPATAYQSFENVMDEVFRDG-VN
A0A087X9B7_BCL2L1-      RDTAREFELRYSRAFNDLHSTLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3B3TUS7_BCL2L1-      RDTAREFELRYSRAFNDLHSTLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3B3WI27_BCL2L1-      RDTAREFELRYSRAFNDLHSTLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3P9N9Y4_BCL2L1-      RDTAREFELRYSRAFNDLHSTLHI---TPATAYQSFENVMDEVFRDG-VN
A0A3Q3BEB7_BCL2L1-      KDSADEFERLYTQSFSHLSLQLDI---SPDTVYHSFKSVLDELFKDG-VN
A0A3P8VMA1_BCL2L1-      KDSADEFELRFTQAFRNLFLKLDL---TPDTVYHSFKSVMDEVFRDG-VN
A0A345BSW9_BCL2L1-      RDSANEFELRYSRAFNDLSSQLHI---TPATAYQSFESVMDEVFRDG-VN
A0A286MU87_BCL2L1-      RDSVDEFELRYTRAFSDLSSQLHI---TPATAYHSFESVMDEVFRDG-VN
A0A3P8XFS0_BCL2L1-      RDSADEFELRYTRAFSDLSSQLHI---TPATAYHSFESVMDEVFRDG-VN
A0A3P8XFS0_BCL2L1-      RDSADEFELRYTRAFSDLSSQLHI---TPATAYHSFESVMDEVFRDG-VN
A0A0F7L1T6_BCL2L1-      RDSAEEFEKLFAQAFSDLSSQLDI---TPDTAYQSFKNVMDEVFKDG-DN
H2U5I3_BCL2L1-01        RDSAEEFEKLFAQAFSDLSSQLDI---TPDTAYQSFKNVMDEVFKDG-VN
H2U5I3_BCL2L1-02        RDSAEEFEKLFAQAFSDLSSQLDI---TPDTAYQSFKNVMDEVFKDG-VN
A0A3Q3J5K3_BCL2L1-      RDSADEFELRFTQAFSDLSSQLVI---TPDTAYNSFKSVMDEVFKDG-VN
A0A3Q1EVP6_BCL2L1-      KDAADEFELLFTQTFSDLSSQIDI---TPETAYHSFKSVMDEVFKDG-VN
A0A3Q1BQA0_BCL2L1-      KDAADEFELLFTQAFSDLSSQLDI---TPETAYHSFKSVMDEVFKDG-VN
A0A3P8U812_BCL2L1-      KDAADEFELLFTQAFSDLSSQLDI---TPETAYHSFKSVMDEVFKDG-VN
E6ZFR0_BCL2L1-01        RDSADEFELLFTQAFSDLSSQIDI---TPDTAYHSFKSVMDEVFKDG-VN
G3P7B4_BCL2L1-01        QDSANEFELLFTQAFSDLSLQLDV---TPDTAYHSFKSVMDEVFKDG-VN
A0A3Q3X5M5_BCL2L1-      RDSANEFEQLFTQAFSDLSSQLDI---TPDTAYHSFKSVMDEVFKDG-VN
A0A2U9BIG9_BCL2L1-      RDSAHEFEQLFNQAFSDLSLQLDI---TPDTAYQSFKSVMDEVFKDG-VN
Q6GLI5_BCL2L1-01        LDASEEFELRYQRAFSDLTAQLHL---TQDTAQQSFQQVVGELFRDG-TN
Q2TAP5_BCL2L1-01        LEATEEFELRYQRAFSDLTSQLHI---TQDTAQQSFQQVMGELFRDG-TN
Q91828_BCL2L1-01        LEATEEFELRYQRAFSDLTSQLHI---TQDTAQQSFQQVMGELFRDG-TN
I7GKS6_BCL2L1-01        KRTGLRPQKGLNRRWRPPVPSMATHPGTPGTAYQSFEQVVNELFRDG-VN
A0A2K5EBP4_BCL2L1-      KRTGLRPQKGLIRRWRPPVPSMLHI--TPGTAYQSFEQVVNELFRDG-VN
A0A2K6UWY8_BCL2L1-      KRTGLRPQKGLIRRWRPPVPSMLHI--TPGTAYQSFEQVVNELFRDG-VN
A0A3Q1LRT3_BCL2L1-      REASNEFKLRYQQTFSDLMSQLRI---TPGTACQSFEQVINELFRDR-VK
A0A2K5M8B1_BCL2L1-      KRTGLRPQKGLNRRWRPPVPSMAT---HPGTAYQSFEQVVNELFRDG-VN
A0A2K5H963_BCL2L1-      KRTGLRPQKGLNRRWRPPVPSMAT---HPGTAYQSFEQVVNELFRDG-VN
G3RY91_BCL2L1-02        KRTGLRPQKGLNRRWRPPVPSMAT---HPGTAYQSFEQVVNELFRDG-VN
A0A2K5VPG2_BCL2L1-      KRTGLRPQKGLNRRWRPPVPSMAT---HPGTAYQSFEQVVNELFRDG-VN
F6UKR4_BCL2L1-02        KRTGLRPQKGLNRRWRPPVPSMAT---HPGTAYQSFEQVVNELFRDG-VN
A0A2K5YR37_BCL2L1-      KRTGLRPQKGLNRRWRPPVPSMAT---HPGTAYQSFEQVVNELFRDG-VN
A0A2K6LPM4_BCL2L1-      KRTGLRPQKGLNRRWRPPVPSMAT---HPGTAYQSFEQVVNELFRDG-VN
A0A2K6QFA2_BCL2L1-      KRTGLRPQKGLNRRWRPPVPSMAT---HPGTAYQSFEQVVNELFRDG-VN
A0A2K6G3C5_BCL2L1-      KRTGLRPQKRLNRRWRPPVPLMAT---HPGTAYQSFEQVVNELFRDG-VN
H9GHK7_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TLGTAYQSFEQVVNELFHDG-VN
Q07816_BCL2L1-04        RDAGDEFELR--GFVRGERGQGDA---GTGGTHCVLDDHVLDRPSRS-LD
Q07817_BCL2L1-02        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQ------------
A0A2K5YR37_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQ------------
A0A452E1B1_BCL2L1-      REASNECELRYQQTFSDLTSQLHI---TPGTTYQSFEQVINELFQDG-VN
W5PSA5_BCL2L1-01        REASNECELRYQQTFSDLTSQLHI---TPGKAYQSFEQVINELFQDG-VN
Q07816_BCL2L1-01        RDAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFHDG-VN
Q07816_BCL2L1-03        RDAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFHDG-VN
Q07816_BCL2L1-02        RDAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFHDG-VN
G1N5N5_BCL2L1-01        RDAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFHDG-VN
A0A452ILL8_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A452ILL8_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
K7F655_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TLGTAYQSFEQVVNELFRDG-VN
A0A287CZ07_BCL2L1-      REAGDEFELWYWRAFSDLTSQLHI---TLGTAYQSFEQVVNELFRDG-VN
F6WA14_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
G3WKX6_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
F6WQI0_BCL2L1-02        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
G3SPN0_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
H0X6V2_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q2PFS6_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
P53563_BCL2L1-02        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
P53563_BCL2L1-03        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
O35843_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
G1RER8_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q64373_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q64373_BCL2L1-09        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
P53563_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2U3V0P1_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
O77737_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVLNELFRDG-VN
Q9MYW4_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
F6WQI0_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
B2Z3Z4_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q05KJ0_BCL2L1-02        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q05KJ0_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
E2IV76_BCL2L1-01        KEAGDEFELRYRRAFSDLTSQLHI---TLGTAYQSFEQVVNELFRDG-VN
A0A2K6G3C5_BCL2L1-      KEAGDEFELRYRRAFSDLTSQLHI---TLGTAYQSFEQVVNELFRDG-VN
M3Z2H9_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A0D9RJZ8_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A286Y5D6_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A1L5BWY3_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
I3MUP5_BCL2L1-03        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
I3MUP5_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
I3MUP5_BCL2L1-02        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
G1P9D2_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2K5EBP4_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
E2IV75_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
F7IT34_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
F7IT34_BCL2L1-02        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q76LT7_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2K5M8B1_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2K5H963_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
M3XA94_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q8SQ42_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
G3RY91_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q07817_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q07817_BCL2L1-03        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2K5VPG2_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
F6UKR4_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2K5YR37_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2J8VIH3_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2K6LPM4_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2K6QFA2_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2K6QFA2_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A2K6UWY8_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
E2IV77_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A452SDS4_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A384D3U1_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
A0A452FWV3_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q9MZS7_BCL2L1-01        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q64373_BCL2L1-03        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
Q64373_BCL2L1-04        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
P53563_BCL2L1-04        REAGDEFELRYRRAFSDLTSQLHI---TPGTAYQSFEQVVNELFRDG-VN
                               :                       .   :              

A0A3Q1GS47_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
R4JQR8_BCL2L1-01        WGRIVALFGFGGSLS----------VKCVQRGMPQLVDS-----IVDWVS
A0A346RRN1_BCL2L1-      WGRVVALFGFGGALS----------VECVQNGMPQLVDS-----IVDWVS
A0A452FIG6_BCL2L1-      WDHTVAFFSFRGALC----------MESVDKEMQVLVSQ-----VMTWMA
A0A452FIG6_BCL2L1-      WDHTVAFFSFRGALC----------MESVDKEMQVLVSQ-----VMTWMA
H3ANS8_BCL2L1-01        WGRVVAFFAFGGALC----------VESMDKEMSSLVER-----IAEWMT
H0Z8G3_BCL2L1-01        WGRIVAFFSFGGALC----------VESVVKEMRVLVKR-----IVSWMT
U3JSL7_BCL2L1-01        WGRIVAFFSFGGALC----------VESVVKEMRVLVKR-----IVSWMT
Q4U2V6_BCL2L1-01        WGRIVAFFSFGGALC----------VESVVKEMRVLVKR-----IVSWMT
A0A3B3ICL7_BCL2L1-      WGRVVGLFVFGGALC----------VECVERNMGELVSR-----IAEWMT
A0A3B3E2W4_BCL2L1-      WGRVVGLFVFGGVLC----------VECVERNMSELVSR-----IAEWMT
A0A3B5B4X7_BCL2L1-      WGRIVGLFCFGGVLC----------VECVDKNMNELVPR-----IADWMT
A0A3B4BFZ8_BCL2L1-      WGRIVGLFVFGGVLS----------VECVEKDMSILVPR-----IANWMT
A0A3Q3FUB6_BCL2L1-      WGRIVGLFAFGGVLC----------VECVQKDMGELVSR-----IAGWMT
A0A3B5MGS2_BCL2L1-      WGRVVAMFTFGGILC----------VDCVQKNMSELVSR-----IAEWMT
M4A558_BCL2L1-01        WGRVVAMFTFGGILC----------VDCVQKNMSELVSR-----IAEWMT
A0A3P9QFB3_BCL2L1-      WGRVVAMFTFGGILC----------VDCVQKNMSELVSR-----IAEWMT
A0A087YBW4_BCL2L1-      WGRVVAMFTFGGILC----------VDCVQKNMSELVSR-----IAEWMT
A0A3B3VWI7_BCL2L1-      WGRVVAMFTFGGILC----------VDCVQKNMSELVSR-----IAEWMT
A0A3B3XN57_BCL2L1-      WGRVVAMFTFGGILC----------VDCVQKNMSELVSR-----IAEWMT
A0A3Q2C6K4_BCL2L1-      WGRVVGLFAFGGVLC----------VHCVQKNMSELVSR-----IADWMT
A0A3Q2NRP4_BCL2L1-      WGRVVGLFAFGGVLC----------VDCVQKNMSELVPR-----IADWMT
A0A0B4KJI5_BCL2L1-      WGRVVGLFAFGGVLC----------VECVEKDTSELVSR-----IADWMT
A0A3Q1JZ46_BCL2L1-      WGRIVGLFAFGGVLC----------VECVEKNMSELVSR-----IADWMT
A0A3Q1JZ46_BCL2L1-      WGRIVGLFAFGGVLC----------VECVEKNMSELVSR-----IADWMT
A0A3Q3NFM4_BCL2L1-      WGRIVGLFAFGGVLC----------VECIEKNMSALVSR-----IADWMT
A0A3Q3NFM4_BCL2L1-      WGRIVGLFAFGGVLC----------VECIEKNMSALVSR-----IADWMT
A0A3B4V9K8_BCL2L1-      WGRIVGLFAFGGVLC----------VECIQKNMSELVSR-----ITDWMT
A0A3B4XS24_BCL2L1-      WGRIVGLFAFGGVLC----------VECIQKNMSELVSR-----IADWMT
C1BLI0_BCL2L1-01        WGRVVGLFAFGGALC----------AECVEKDMSHLVAR-----IADWMT
C0HAD8_BCL2L1-01        WGRVVGLFAFGGALC----------VECVEKDMSPLVAR-----IADWMT
A0A3B3ZN55_BCL2L1-      WGRVVGLFAFGGALA----------VECVDKEMSTLVAR-----IVTWMT
A0A3B5K6B9_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IIEWMT
A0A3B5K6B9_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IIEWMT
H3CH49_BCL2L1-01        WGRIVGLFAFGGALC----------VECVEKEMNPLVGR-----IIEWMT
A0A3B3TFR4_BCL2L1-      WGRVVGLFAFGGALC----------VECVEKEMSPLVGH-----IVDWMT
A0A3Q2FR43_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3P8XYL5_BCL2L1-      WGRVVGLFAFGGALC----------VECVEKEMSPLVGR-----IADWMT
Q90Z98_BCL2L1-02        WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IAEWMT
Q90Z98_BCL2L1-01        WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IAEWMT
A0A059PJI5_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVAR-----IAEWMT
A0A3B4DTL9_BCL2L1-      WGRVVGLFAFGGALC----------VECVEKEMSPLVGR-----IAEWMT
B5XAY3_BCL2L1-01        WGRVVGLFSFGGALC----------VECVDKEMNPLVGR-----ITDWMT
W5MG74_BCL2L1-01        WGRIVGLFAFGGALC----------VECVEKEMSNLVSR-----IAEWMT
A0A3Q3B3X5_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSHLVAR-----IVEWMT
A0A3B3IB64_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVDR-----IVEWMT
A0A3P9JYH1_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVDR-----IVEWMT
A0A3B3DHA1_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVDR-----IVEWMT
A0A3Q0RTF8_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
I3IZK7_BCL2L1-01        WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A2U9BY16_BCL2L1-      WGRIIGLFAFGGALS----------VECVEKEMSSLVGR-----IVEWMT
A0A0D6DR75_BCL2L1-      WGRIIGLFAFGGALC----------VECVEKEMSQLVVR-----IVEWMT
A0A3Q3WIW8_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IIEWMT
A0A219P0Y3_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IIEWKT
A0A3Q3MX20_BCL2L1-      WGRIIGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3Q3G2E1_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IIEWMT
A0A3Q3G2E1_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IIEWMT
A0A3Q3G2E1_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IIEWMT
A0A3Q1GZ93_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSQLVGR-----IVEWMT
A0A3Q1GZ93_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSQLVGR-----IVEWMT
A0A3Q1GZ93_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSQLVGR-----IVEWMT
A0A3B4V3T1_BCL2L1-      WGRIIGLFVFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3B4XU17_BCL2L1-      WGRIIGLFVFGGALC----------VECVEKEMSPLVGR-----IVEWMT
D2ITA2_BCL2L1-02        WGRIVGLFAFGGALC----------VECVEKEMSHMVPR-----VAEWMT
A0A3B3ICL7_BCL2L1-      WGRVVGLFVFGGALC----------VECVERNMGELVSR-----IAEWMT
A0A3B3QRZ2_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMGHLVDR-----IADWMT
A0A3B3ZN55_BCL2L1-      WGRVVGLFAFGGALA----------VECVDKEMSTLVAR-----IVTWMT
G3NJY1_BCL2L1-01        WGRIVGLFAFGGALC----------VECVDKEMSPLVGR-----IVEWMT
A0A3Q3DUT7_BCL2L1-      WGRIVGLFAFGGALC----------VECMEKEMIPLVDR-----IIEWMT
A0A3Q3DUT7_BCL2L1-      WGRIVGLFAFGGALC----------VECMEKEMIPLVDR-----IIEWMT
A0A3Q3DUT7_BCL2L1-      WGRIVGLFAFGGALC----------VECMEKEMIPLVDR-----IIEWMT
A0A3B1JJ42_BCL2L1-      WGRVVGLFAFGGALC----------VECVEKEMSPLVGR-----IAEWMT
A0A3P8UWG7_BCL2L1-      WGRIIGLFAFGGALS----------VECVEKEMSQLVAR-----IADWMT
A0A3Q3IVF5_BCL2L1-      WGRIIGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3Q1DHJ3_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3Q1DHJ3_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3Q1DHJ3_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3P8TL99_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3P8TL99_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3Q1GS47_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3B4Z3X2_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3B4Z3X2_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
C3VIT1_BCL2L1-01        WGRIVGLFAFGGALC----------VECVEREMSPLVGR-----IVEWMT
A0A3P8P0F1_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3Q2X557_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3P9D632_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3P9D632_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3Q4N4B5_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3B4FNX1_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3Q2QPL9_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IVEWMT
A0A3B5PQJ0_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSHLVAR-----IVEWMT
A0A087X9B7_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSHLVAR-----IVEWMT
A0A3B3TUS7_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSHLVAR-----IVEWMT
A0A3B3WI27_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSHLVAR-----IVEWMT
A0A3P9N9Y4_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSHLVAR-----IVEWMT
A0A3Q3BEB7_BCL2L1-      WGRVVGLFAFGGVLC----------VQCVERDMSELVSR-----IADWMT
A0A3P8VMA1_BCL2L1-      WGRIVGLFTFGGVLC----------VECVQRNMSELVPR-----IADWMT
A0A345BSW9_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKEMSPLVGR-----IAEWMT
A0A286MU87_BCL2L1-      WGRVVGLFAFGGALC----------VECVEKDMSPLVAR-----IADWMT
A0A3P8XFS0_BCL2L1-      WGRVVGLFAFGGALC----------VECVEKDMSLLVAR-----IADWMT
A0A3P8XFS0_BCL2L1-      WGRVVGLFAFGGALC----------VECVEKDMSLLVAR-----IADWMT
A0A0F7L1T6_BCL2L1-      WGRVVGLFAFGGVLC----------VECVERDASQLVCR-----IADWMT
H2U5I3_BCL2L1-01        WGRVVGLFAFGGVLC----------VECVEKDASQLVCR-----IADWMT
H2U5I3_BCL2L1-02        WGRVVGLFAFGGVLC----------VECVEKDASQLVCR-----IADWMT
A0A3Q3J5K3_BCL2L1-      WGRIVGLFAFGGALC----------VECVEKNMSELVSR-----IADWMT
A0A3Q1EVP6_BCL2L1-      WGRIVGLFCFGGVLC----------VECVEKNMSELVPR-----IADWMT
A0A3Q1BQA0_BCL2L1-      WGRIVGLFCFGGVLC----------VECVEKNMSELVPR-----IADWMT
A0A3P8U812_BCL2L1-      WGRIVGLFCFGGVLC----------VECVDKNMSELVPR-----IADWMT
E6ZFR0_BCL2L1-01        WGRIVGLFAFGGVLC----------VECVEKDMSELVSR-----IADWMT
G3P7B4_BCL2L1-01        WGRVVGLFAFGGVLC----------VECVEKDMTELVSR-----IADWMT
A0A3Q3X5M5_BCL2L1-      WGRIVGLFAFGGVLC----------VECAEKDTGELVCR-----IADWMT
A0A2U9BIG9_BCL2L1-      WGRIVGLFAFGGVLC----------VECVEKNRGELVAR-----IADWMT
Q6GLI5_BCL2L1-01        WGRIVAFFSFGRALC----------VESANKEMTELLPR-----IVQWMV
Q2TAP5_BCL2L1-01        WGRIVAFFSFGRALC----------VESANKEMTDLLPR-----IVQWMV
Q91828_BCL2L1-01        WGRIVAFFSFGRALC----------VESANKEMTDLLPR-----IVQWMV
I7GKS6_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K5EBP4_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K6UWY8_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A3Q1LRT3_BCL2L1-      WGHVVAFFSFSGTLC----------MKSIDKEIHVLVSQ-----VTTSTA
A0A2K5M8B1_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K5H963_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
G3RY91_BCL2L1-02        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K5VPG2_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
F6UKR4_BCL2L1-02        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K5YR37_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K6LPM4_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K6QFA2_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K6G3C5_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
H9GHK7_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQGLVVR-----IASWMT
Q07816_BCL2L1-04        PGEWRL-----GALCGSVWEQRCCRAEEGPGDLQQMAPHRGDRGRSASAG
Q07817_BCL2L1-02        --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A452E1B1_BCL2L1-      WCRNVAFFSFGGALC----------MKSIVKEMQVLVSQ-----VTTWMA
W5PSA5_BCL2L1-01        WGRNVAFFSFGGALC----------MKSIVKEMQVLVSQ-----VTTWMA
Q07816_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMRVLVGR-----IVSWMT
Q07816_BCL2L1-03        WGRIVAFFSFGGALC----------VESVDKEMRVLVGR-----IVSWMT
Q07816_BCL2L1-02        WGRIVAFFSFGGALC----------VESVDKEMRVLVGR-----IVSWMT
G1N5N5_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMRVLVGR-----IVSWMT
A0A452ILL8_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVGR-----IVSWMT
A0A452ILL8_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVGR-----IVSWMT
K7F655_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVGR-----IASWMT
A0A287CZ07_BCL2L1-      WGHIVAFLSFGGALC----------MESVDKEMQVLVSR-----IASWM-
F6WA14_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMEVLVGR-----ITSWMA
G3WKX6_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMEVLVAR-----ITSWMA
F6WQI0_BCL2L1-02        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
G3SPN0_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
H0X6V2_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
Q2PFS6_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
P53563_BCL2L1-02        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
P53563_BCL2L1-03        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
O35843_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
G1RER8_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
Q64373_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
Q64373_BCL2L1-09        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
P53563_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
A0A2U3V0P1_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
O77737_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
Q9MYW4_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMEVLVSR-----IAAWMA
F6WQI0_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
B2Z3Z4_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
Q05KJ0_BCL2L1-02        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
Q05KJ0_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
E2IV76_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
A0A2K6G3C5_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
M3Z2H9_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQALVSR-----IATWMA
A0A0D9RJZ8_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A286Y5D6_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVRR-----IASWMA
A0A1L5BWY3_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
I3MUP5_BCL2L1-03        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
I3MUP5_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
I3MUP5_BCL2L1-02        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
G1P9D2_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
A0A2K5EBP4_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
E2IV75_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
F7IT34_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
F7IT34_BCL2L1-02        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
Q76LT7_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K5M8B1_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K5H963_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
M3XA94_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
Q8SQ42_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
G3RY91_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
Q07817_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
Q07817_BCL2L1-03        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K5VPG2_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
F6UKR4_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K5YR37_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2J8VIH3_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K6LPM4_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K6QFA2_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K6QFA2_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A2K6UWY8_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
E2IV77_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IAAWMA
A0A452SDS4_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
A0A384D3U1_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
A0A452FWV3_BCL2L1-      WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
Q9MZS7_BCL2L1-01        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IATWMA
Q64373_BCL2L1-03        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
Q64373_BCL2L1-04        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
P53563_BCL2L1-04        WGRIVAFFSFGGALC----------VESVDKEMQVLVSR-----IASWMA
                                                                          

A0A3Q1GS47_BCL2L1-      VYLDNHIQDWIQG-QGGW------------ERFAEIFGQ-DAAAESRRSQ
R4JQR8_BCL2L1-01        TYLCNSLEQWITD-NGGW------------QGFVEAYNQGQNHNDSPWDV
A0A346RRN1_BCL2L1-      VYLCDNLEPWITS-NGGW------------QGFVEYYNQAQNHNDNQWNL
A0A452FIG6_BCL2L1-      SQLNDHLEPWIQE-NGGW------------DTSVEFCEN-NTATESQKGQ
A0A452FIG6_BCL2L1-      SQLNDHLEPWIQE-NGGW------------DTSVEFCEN-NTATESQKGQ
H3ANS8_BCL2L1-01        TYLDDNLNPWIQE-QGGW------------ATIIHIDGV-DAMQRSNTRS
H0Z8G3_BCL2L1-01        TYLTDHLDPWIQE-NGGW------------ERFVDSM-N-DAAAEMRKGQ
U3JSL7_BCL2L1-01        TYLTDHLDPWIQE-NGGW------------ERFVDLYGN-DAAAEVRKGQ
Q4U2V6_BCL2L1-01        TYLTDHLDPWIQE-NGGW------------ERFVDLYGN-DAAAEMRKGQ
A0A3B3ICL7_BCL2L1-      QYLDEQISPWIHS-HGGW------------DCFARLYGQ-NGAAEARRFQ
A0A3B3E2W4_BCL2L1-      MYLDEQISPWIHS-QGGW------------DCFAQLYGQ-DGAAEARRFQ
A0A3B5B4X7_BCL2L1-      MYLDEHISLWIQS-QGGW------------ECFAEIFGQ-DAAAEARRSR
A0A3B4BFZ8_BCL2L1-      IYLDENIATWIQN-QGGW------------ASFAQIFGQ-NAAGEARRSR
A0A3Q3FUB6_BCL2L1-      TYLDEHISAWIES-QGGW------------DCFVEIFGR-GAVGEVRRSR
A0A3B5MGS2_BCL2L1-      TYLDEQLSPWIQS-QGGW------------DRFANLYGQ-DAAAEGRRFR
M4A558_BCL2L1-01        TYLDEQLSPWIQS-QGGW------------DRFANLYGQ-DAAAEGRRFR
A0A3P9QFB3_BCL2L1-      TYLDEQLNPWIQS-QGGW------------DHFANLYGQ-DAAAEGRRFR
A0A087YBW4_BCL2L1-      TYLDEQLNPWIQS-QGGW------------DRFANLYGQ-DAAAEGRRFR
A0A3B3VWI7_BCL2L1-      TYLDEQLNPWIQS-QGGW------------DRFANLYGQ-DAAAEGRRFR
A0A3B3XN57_BCL2L1-      TYLDEQLNPWIQS-QGGW------------DRFANLYGQ-DAAAEGRRFR
A0A3Q2C6K4_BCL2L1-      IYLDEQLNPWIHS-QGGW------------DCFAKLYGQ-DAAAEGRRSH
A0A3Q2NRP4_BCL2L1-      IYLDEQLDPWVRS-QGGW------------ECFAKLYGQ-DAAAAGRRFQ
A0A0B4KJI5_BCL2L1-      MYLDEHINPWIES-QGGW------------DSFAEVFGR-DAAAEARRSR
A0A3Q1JZ46_BCL2L1-      MYLDEHISPWIQS-QGGW------------DCFAEIFGQ-DAAAEARRSR
A0A3Q1JZ46_BCL2L1-      MYLDEHISPWIQS-QGGW------------DCFAEIFGQ-DAAAEARRSR
A0A3Q3NFM4_BCL2L1-      MYLDEHISPWIES-QGGW------------DCFAEIFGR-DAAAEARRSQ
A0A3Q3NFM4_BCL2L1-      MYLDEHISPWIES-QGGW------------DCFAEIFGR-DAAAEARRSQ
A0A3B4V9K8_BCL2L1-      MYLDEHISPWIQS-QGGW------------DCFAEMFGQ-DAAAEARRSR
A0A3B4XS24_BCL2L1-      MYLDEHISPWIQS-QGGW------------DCFAEMFGQ-DAAAEARRSR
C1BLI0_BCL2L1-01        TYLDNHIQPWIQR-QGGW------------DRFADIFGR-DAAAEVRRSQ
C0HAD8_BCL2L1-01        TYLDNHIQPWIQS-QGGW------------DRFAEIFGR-DAAADVRRSQ
A0A3B3ZN55_BCL2L1-      VYLDEHIQDWIDS-QGGW------------ARFAEIYGQ-DAAAQSRHSE
A0A3B5K6B9_BCL2L1-      VYLDNHIQPWIQS-QGGW------------VRFAELFGQ-DAAAESRRSQ
A0A3B5K6B9_BCL2L1-      VYLDNHIQPWIQS-QGGW------------VRFAELFGQ-DAAAESRRSQ
H3CH49_BCL2L1-01        VYLDNHIQPWIQS-QGGW------------ERFAELFGQ-DAAAESRRSQ
A0A3B3TFR4_BCL2L1-      VYLDNHIQPWIQT-QGGW------------DRFAEIFGN-DAAAEGRRSR
A0A3Q2FR43_BCL2L1-      VYLDEQIDPWIQS-QGGW------------ERFAEIFGG-DAAAESRRSQ
A0A3P8XYL5_BCL2L1-      VYLDNHIQPWIES-QGGW------------DRFAEIFGK-DAAANSRKSQ
Q90Z98_BCL2L1-02        VYLDNHIQPWIQS-QGGW------------ERFAEIFGK-DAAAESRKSQ
Q90Z98_BCL2L1-01        VYLDNHIQPWIQS-QGGW------------ERFAEIFGK-DAAAESRKSQ
A0A059PJI5_BCL2L1-      VYLDNHIQPWIEE-QGGW------------ERFAEIFGK-DAAAEGRRSQ
A0A3B4DTL9_BCL2L1-      VYLDNHIQPWIQE-QGGW------------ERFAEIFGK-DAAAESRRSQ
B5XAY3_BCL2L1-01        VYLDNHIQPWIQS-QGGW------------DRFAEIFGM-DAAAESRKSQ
W5MG74_BCL2L1-01        VYLDNNIQPWIQS-QGGW------------DRFAEIFGK-DAAAEYRRSQ
A0A3Q3B3X5_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAEIFGD-NAAAESRISQ
A0A3B3IB64_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-EAAAESRRSQ
A0A3P9JYH1_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-EAAAESRRSQ
A0A3B3DHA1_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-EAAAESRRSQ
A0A3Q0RTF8_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-DAAAESRRSQ
I3IZK7_BCL2L1-01        VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-DAAAESRRSQ
A0A2U9BY16_BCL2L1-      VYLDNNIQPWIQS-QGGW------------EHFAEIFGQ-DAAAGSRRSQ
A0A0D6DR75_BCL2L1-      VYLDDHIQPWIQS-QGGW------------EHFAEIFGH-DAAAESRRSQ
A0A3Q3WIW8_BCL2L1-      VYLDNQIQPWIES-QGGW------------QRFAEIFGQ-DAAAESRRSQ
A0A219P0Y3_BCL2L1-      RYLDNHIQPWIQS-QRGW------------ERFAEIFGQ-DAAAESRRSQ
A0A3Q3MX20_BCL2L1-      LYLDNHIEPWIQS-QGGW------------EHFAEIFGQ-DAAAESRRSQ
A0A3Q3G2E1_BCL2L1-      VYLDNRIQPWIES-QGGW------------ERFSEIFGQ-DAAGEIRRSQ
A0A3Q3G2E1_BCL2L1-      VYLDNRIQPWIES-QGGW------------ERFSEIFGQ-DAAGEIRRSQ
A0A3Q3G2E1_BCL2L1-      VYLDNRIQPWIES-QGGW------------ERFSEIFGQ-DAAGEIRRSQ
A0A3Q1GZ93_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAELFGH-DAAAEGRRSQ
A0A3Q1GZ93_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAELFGH-DAAAEGRRSQ
A0A3Q1GZ93_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAELFGH-DAAAEGRRSQ
A0A3B4V3T1_BCL2L1-      VYLDNRIQPWIQS-QGGW------------ERFAEIFGQ-DAAAESRRSQ
A0A3B4XU17_BCL2L1-      VYLDNRIQPWIQS-QGGW------------ERFAEIFGQ-DAAADSRRSQ
D2ITA2_BCL2L1-02        RYLDDHIDHWIQS-NGGW------------KHFAAVFGS-DAAAGARRTR
A0A3B3ICL7_BCL2L1-      QYLDEQISPWIHS-HGGW------------DCFARLYGQ-NGAAEARRFQ
A0A3B3QRZ2_BCL2L1-      VYLDSNIQPWIQR-QGGW------------DRFAEIFGK-DAAAESRRSQ
A0A3B3ZN55_BCL2L1-      VYLDEHIQDWIDS-QGGW------------ARFAEIYGQ-DAAAQSRHSE
G3NJY1_BCL2L1-01        LYLDNHIQPWIQN-QGGW--------------------------------
A0A3Q3DUT7_BCL2L1-      VYLDNHLQPWIES-QGGW------------QRFAEIFGH-DAAAEVRRSQ
A0A3Q3DUT7_BCL2L1-      VYLDNHLQPWIES-QGGW------------QRFAEIFGH-DAAAEVRRSQ
A0A3Q3DUT7_BCL2L1-      VYLDNHLQPWIES-QGGW------------QRFAEIFGH-DAAAEVRRSQ
A0A3B1JJ42_BCL2L1-      VYLDNHIQPWIQE-QGGW------------ERFAEIFGN-DTAAESRRMQ
A0A3P8UWG7_BCL2L1-      VYLDNHIQPWIET-QGGW------------EHFAELFGQ-DAAAESRRSQ
A0A3Q3IVF5_BCL2L1-      VYLDNHIQPWIQG-QGGW------------ERFAELFGQ-DAAAENRRSQ
A0A3Q1DHJ3_BCL2L1-      VYLDNHIQDWIQS-QGGW------------ERFAEIFGQ-DAAAESRKSQ
A0A3Q1DHJ3_BCL2L1-      VYLDNHIQDWIQS-QGGW------------ERFAEIFGQ-DAAAESRKSQ
A0A3Q1DHJ3_BCL2L1-      VYLDNHIQDWIQS-QGGW------------ERFAEIFGQ-DAAAESRKSQ
A0A3P8TL99_BCL2L1-      VYLDNHIQDWIQS-QGGW------------ERFAEIFGQ-DAAAESRKSQ
A0A3P8TL99_BCL2L1-      VYLDNHIQDWIQS-QGGW------------ERFAEIFGQ-DAAAESRKSQ
A0A3Q1GS47_BCL2L1-      VYLDNHIQDWIQG-QGGW------------ERFAEIFGQ-DAAAESRRSQ
A0A3B4Z3X2_BCL2L1-      VYLDNHIQDWIQS-QGGW------------DRFAEIFGQ-DAAAESRRSQ
A0A3B4Z3X2_BCL2L1-      VYLDNHIQDWIQS-QGGW------------DRFAEIFGQ-DAAAESRRSQ
C3VIT1_BCL2L1-01        VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-DAAAESRRSQ
A0A3P8P0F1_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-DAAAESRRSQ
A0A3Q2X557_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-DAAAESRRSQ
A0A3P9D632_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-DAAAESRRSQ
A0A3P9D632_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-DAAAESRRSQ
A0A3Q4N4B5_BCL2L1-      VYLDNHIQPWIQS-QGGW------------EHFAEIFGQ-DAAAESRRSQ
A0A3B4FNX1_BCL2L1-      VYLDNHIQPWIQS-QGGW------------ERFAEIFGQ-DAAAESRRSQ
A0A3Q2QPL9_BCL2L1-      VYLDEQIDPWIQS-QGGW------------ERFAEIFGG-NAAAESRRSQ
A0A3B5PQJ0_BCL2L1-      VYLDEQIEPWVES-QGGW------------ERFAEIFGG-NAAAESRRSQ
A0A087X9B7_BCL2L1-      VYLDERIEPWVES-QGGW------------DRFAEIFGG-NAAAESRRSQ
A0A3B3TUS7_BCL2L1-      VYLDERIEPWVES-QGGW------------DRFAEIFGG-NAAAESRRSQ
A0A3B3WI27_BCL2L1-      VYLDERIEPWVES-QGGW------------DRFAEIFGG-NAAAESRRSQ
A0A3P9N9Y4_BCL2L1-      VYLDERIEPWVES-QGGW------------ERFAEIFGG-NAAAESRRSQ
A0A3Q3BEB7_BCL2L1-      VYLDEQIGPWIDS-QGGW------------DSFAEMYGR-DAAAEARRFQ
A0A3P8VMA1_BCL2L1-      MYLDEYIDPWIQS-QGGW------------DRFAEIFGT-DCIPRTRSCR
A0A345BSW9_BCL2L1-      VYLDNHIQPWIQS-QGGW-----------------VSGK-----------
A0A286MU87_BCL2L1-      TYLDNHIQPWIQS-QGGW---------------AEIFGR-DAAADVRRSQ
A0A3P8XFS0_BCL2L1-      TYLDEHIQPWIQI-QGGW------------DRFADIFGR-DAAADIRRSQ
A0A3P8XFS0_BCL2L1-      TYLDEHIQPWIQI-QGGW------------DRFADIFGR-DAAADIRRSQ
A0A0F7L1T6_BCL2L1-      IYLDEHINPWIQS-QGGW------------DCFAKIFGD-DAAAEGRRAR
H2U5I3_BCL2L1-01        IYLDEHINPWIQS-QGGW------------DCFAKIFGD-DAAAEGRRAR
H2U5I3_BCL2L1-02        IYLDEHINPWIQS-QGGW------------DCFAKIFGD-DAAAEGRRAR
A0A3Q3J5K3_BCL2L1-      MYLDEHISPWIQN-QGGW------------DCFAEIFGR-DNAAEVRRSQ
A0A3Q1EVP6_BCL2L1-      MYLDEHISPWIQS-QGDW------------ECFAEIFGQ-NAAAEARRSR
A0A3Q1BQA0_BCL2L1-      MYLDEHISPWIQS-QGGW------------ECFAEIFGQ-NAAAEARRSR
A0A3P8U812_BCL2L1-      MYLDEHISPWIQS-QGGW------------ECFAEIFGQ-NAAAEARRSR
E6ZFR0_BCL2L1-01        MYLDEHISPWIQS-QGGW------------DCFAEVFGR-DAAAEARRSR
G3P7B4_BCL2L1-01        TYLDEHISAWIQS-QGGW------------DCFADIFGR-DGAAAARRSQ
A0A3Q3X5M5_BCL2L1-      TYLDEHINPWIQS-QGGW------------GCFAEVFGH-NAAAEARRSQ
A0A2U9BIG9_BCL2L1-      MYLDEHISPWIQS-QGGW------------GCFAEIFGQ-GAGAEARRYR
Q6GLI5_BCL2L1-01        QYLEHTLQPWMLE-NGGW------------EAFVGLYGK-GAAAQSREGP
Q2TAP5_BCL2L1-01        NYLEHTLQPWMQE-NGGW------------EAFVGLYGK-NAAAQSRESQ
Q91828_BCL2L1-01        NYLEHTLQPWMQE-NGGW------------EAFVGLYGK-NAAAQSRESQ
I7GKS6_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K5EBP4_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K6UWY8_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A3Q1LRT3_BCL2L1-      TYLNNHLKPWIQE-NGGW------------DTFVELYES-NTTNESQKGQ
A0A2K5M8B1_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K5H963_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
G3RY91_BCL2L1-02        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K5VPG2_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
F6UKR4_BCL2L1-02        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K5YR37_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K6LPM4_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K6QFA2_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K6G3C5_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
H9GHK7_BCL2L1-01        TYLTEHLDPWIQE-NGGW--------------------------KSKGG-
Q07816_BCL2L1-04        IPAEPQVTPWLCPLAPGW---------------LRLHTS-TTQ-------
Q07817_BCL2L1-02        ------------------------------DTFVELYGN-NAAAESRKGQ
A0A2K5YR37_BCL2L1-      ------------------------------DTFVELYGN-NAAAESRKGQ
A0A452E1B1_BCL2L1-      TYLNNHLEPWIQE-NGDW------------DIFVELYEN-NTATESQKGQ
W5PSA5_BCL2L1-01        TYLNDHLEPWIQE-NGDW------------DIFVELYEN-NTATESQKGQ
Q07816_BCL2L1-01        TYLTDHLDPWIQE-NGGW------------ERFVDLYGN-NAAAELRKGQ
Q07816_BCL2L1-03        TYLTDHLDPWIQE-NGGW------------ERFVDLYGN-NAAAELRKGQ
Q07816_BCL2L1-02        TYLTDHLDPWIQE-NGGW------------ERFVDLYGN-NAAAELRKGQ
G1N5N5_BCL2L1-01        TYLTDHLDPWIQE-NGGW------------ERFVDLYGN-NAAAELRKGQ
A0A452ILL8_BCL2L1-      TYLTDHLDPWIQE-NGGW------------ERFVDLYGN-DAAAKSRKGQ
A0A452ILL8_BCL2L1-      TYLTDHLDPWIQE-NGGW------------ERFVDLYGN-DAAAKSRKGQ
K7F655_BCL2L1-01        TYLTDHLDPWIQE-NGGW------------ERFVDLYGN-DAAAKSRKGQ
A0A287CZ07_BCL2L1-      --------PWIQE-NGGW------------DTFVELYRN-NAAAESRKGQ
F6WA14_BCL2L1-01        TYLDDHLDPWIQE-NGGW------------DTFVELYGN-DAAAESRKGQ
G3WKX6_BCL2L1-01        TYLDEHLDPWIQE-NGGW------------DTFVELYGN-DAAAESRKGQ
F6WQI0_BCL2L1-02        TYLNDHLEPWIQE-NGGWKETALGTFCYFVSSLMRLSGQ-GGALQLAPSY
G3SPN0_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------VRTTPLLCF-STSVKEDIAY
H0X6V2_BCL2L1-01        TYLNDHLEPWIQE-NGGW---------WRCQAFPELLSP-KSNSIYFK--
Q2PFS6_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
P53563_BCL2L1-02        TYLNDHLEPWIQE-NGGW------------VRTTPLVCP-PLVCLSSVEI
P53563_BCL2L1-03        TYLNDHLEPWIQE-NGGW------------VRTTPLVCP-PLVCLSSVEI
O35843_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------GV---------------SGG
G1RER8_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
Q64373_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVDLYGN-NAAAESRKGQ
Q64373_BCL2L1-09        TYLNDHLEPWIQE-NGGW------------DTFVDLYGN-NAAAESRKGQ
P53563_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVDLYGN-NAAAESRKGQ
A0A2U3V0P1_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
O77737_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
Q9MYW4_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
F6WQI0_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
B2Z3Z4_BCL2L1-01        TYLNDHLEPWIQD-NGGW------------DTFVELYGN-NAAAESRKGQ
Q05KJ0_BCL2L1-02        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
Q05KJ0_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
E2IV76_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K6G3C5_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
M3Z2H9_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A0D9RJZ8_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A286Y5D6_BCL2L1-      TYLNDHLEPWIQD-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A1L5BWY3_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
I3MUP5_BCL2L1-03        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
I3MUP5_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
I3MUP5_BCL2L1-02        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
G1P9D2_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K5EBP4_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
E2IV75_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
F7IT34_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
F7IT34_BCL2L1-02        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
Q76LT7_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K5M8B1_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K5H963_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
M3XA94_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
Q8SQ42_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
G3RY91_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
Q07817_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
Q07817_BCL2L1-03        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K5VPG2_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
F6UKR4_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K5YR37_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2J8VIH3_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K6LPM4_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K6QFA2_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K6QFA2_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A2K6UWY8_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
E2IV77_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A452SDS4_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A384D3U1_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
A0A452FWV3_BCL2L1-      TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
Q9MZS7_BCL2L1-01        TYLNDHLEPWIQE-NGGW------------DTFVELYGN-NAAAESRKGQ
Q64373_BCL2L1-03        TYLNDHLEPWIQE-NGGW------------VRTTPLVCP-PLACVSLLCE
Q64373_BCL2L1-04        TYLNDHLEPWIQE-NGGW------------VRTTPLVCP-PLACVSLLCE
P53563_BCL2L1-04        TYLNDHLEPWIQE-NGGW------------VRTTPLVCP-PLVCLSSV-E
                                                                          

A0A3Q1GS47_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVVGSLI---
R4JQR8_BCL2L1-01        KGLVKY-------------------GAIGVIGA-------MALSAFL---
A0A346RRN1_BCL2L1-      GEFVRY-------------------GAIGVVGA-------LALGALL---
A0A452FIG6_BCL2L1-      ERFNCW-------------------SLTAVTLAGGSG---LSRKAAV---
A0A452FIG6_BCL2L1-      ERFNCW-------------------SLTAVTLA---G---LALQLIV---
H3ANS8_BCL2L1-01        EKLGFV-------------------GFFFSFLL--RG---VERNLKL---
H0Z8G3_BCL2L1-01        E-FNKW-------------------LLTGATVA--GV---LLLGSLL---
U3JSL7_BCL2L1-01        ETFNKW-------------------LLTGATVA--GV---LLLGSLL---
Q4U2V6_BCL2L1-01        ETFNKW-------------------LLTGATVA--GV---LLLGSLL---
A0A3B3ICL7_BCL2L1-      ETLKKW-------------------MLVTVALL--TG---LLLGVLI---
A0A3B3E2W4_BCL2L1-      ETLKKW-------------------TLVAVALL--TG---LLLGLLI---
A0A3B5B4X7_BCL2L1-      DSLKRW-------------------LLVGGALL--TG---VLAGVLI---
A0A3B4BFZ8_BCL2L1-      ETLKKW-------------------LLVGVGLL--AG---VLVAMLI---
A0A3Q3FUB6_BCL2L1-      ETLTRW-------------------LLVGMALL--MG---VVVGVYI---
A0A3B5MGS2_BCL2L1-      ETLNKW-------------------LLVGVALL--TG---ALLVVFV---
M4A558_BCL2L1-01        ETLNKW-------------------LLVGVALL--TG---ALLVVFV---
A0A3P9QFB3_BCL2L1-      ETLNKW-------------------LLVGVALL--TG---ALLVMFI---
A0A087YBW4_BCL2L1-      ETLNKW-------------------LLVGVALL--TG---ALLVMFV---
A0A3B3VWI7_BCL2L1-      ETLNKW-------------------LLVGVALL--TG---ALLVMFV---
A0A3B3XN57_BCL2L1-      ETLNKW-------------------LLVGVALL--TG---ALLVMFV---
A0A3Q2C6K4_BCL2L1-      ETLNKW-------------------LLVGAALL--GG---VLLTVLV---
A0A3Q2NRP4_BCL2L1-      ETLNKW-------------------LLVGAALL--TG---FLLVVLF---
A0A0B4KJI5_BCL2L1-      ETLSRW-------------------LLVGVALL--MG---VVLGVLI---
A0A3Q1JZ46_BCL2L1-      EALRRW-------------------LLVGVVLL--TG---VLLGVLI---
A0A3Q1JZ46_BCL2L1-      EALRRW-------------------LLVGVVLL--TG---VLLGVLI---
A0A3Q3NFM4_BCL2L1-      ETLRRW-------------------LLVGVALL--TG---VLIGVLI---
A0A3Q3NFM4_BCL2L1-      ETLRRW-------------------LLVGVALL--TG---VLIGVLI---
A0A3B4V9K8_BCL2L1-      EAVMKW-------------------LLVGVAML--AG---VLMGVLI---
A0A3B4XS24_BCL2L1-      EAVRRW-------------------LLVGVAML--AG---VLMGVLI---
C1BLI0_BCL2L1-01        ENLRRW-------------------LLVGAILL--AG---VLVGSLI---
C0HAD8_BCL2L1-01        ESIIKW-------------------LLVGVILL--SG---VLVGTLI---
A0A3B3ZN55_BCL2L1-      ERFKKW-------------------LFAGMTLV--TG---VVVGSLL---
A0A3B5K6B9_BCL2L1-      ERFRNG-------------------LLVGMSLA--AG---IAIGSFI---
A0A3B5K6B9_BCL2L1-      ERFRNG-------------------LLVGMSLA--AG---IAIGSFI---
H3CH49_BCL2L1-01        ERFRNG-------------------LFLGMSLA--AG---IALGSFI---
A0A3B3TFR4_BCL2L1-      ERFQQW-------------------LPAAMALV--AG---ALVGFLI---
A0A3Q2FR43_BCL2L1-      ESLKNW-------------------LLLGMSVA--TA---LIAGSIF---
A0A3P8XYL5_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
Q90Z98_BCL2L1-02        ESFKKW-------------------LFAGMTLL--TG---VVVGGLI---
Q90Z98_BCL2L1-01        ESFKKW-------------------LFAGMTLL--TG---VVVGGLI---
A0A059PJI5_BCL2L1-      ESFKKW-------------------LLAGVTLF--TG---VVVGSFI---
A0A3B4DTL9_BCL2L1-      ENFKKW-------------------LLAGMTLV--TG---VVVGSLI---
B5XAY3_BCL2L1-01        ESFKKW-------------------LLAGMTLV--TG---VVVGSLF---
W5MG74_BCL2L1-01        ESFKKW-------------------LLAGMTLV--TG---LVVGSYI---
A0A3Q3B3X5_BCL2L1-      EGLKKW-------------------LLVGMTVV--TA---VVAGSLF---
A0A3B3IB64_BCL2L1-      ESFKKW-------------------LLVGMTVA--TG---VLVGSFL---
A0A3P9JYH1_BCL2L1-      ESFKKW-------------------LLVGMTVA--TG---VLVGSFL---
A0A3B3DHA1_BCL2L1-      ESFKKW-------------------LLVGMTVA--TG---VLVGSFI---
A0A3Q0RTF8_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVAGALI---
I3IZK7_BCL2L1-01        ESFKKW-------------------LLVGMTVV--TG---VVAGALI---
A0A2U9BY16_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A0D6DR75_BCL2L1-      ESFKKW-------------------LLAGMTVV--TG---VVAGALI---
A0A3Q3WIW8_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A219P0Y3_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3Q3MX20_BCL2L1-      ENFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3Q3G2E1_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3Q3G2E1_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3Q3G2E1_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3Q1GZ93_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3Q1GZ93_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3Q1GZ93_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3B4V3T1_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3B4XU17_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
D2ITA2_BCL2L1-02        DSHRRW-------------------MLVGAALL--TG---VLLGALL---
A0A3B3ICL7_BCL2L1-      ETLKKW-------------------MLVTVALL--TG---LLLGVLI---
A0A3B3QRZ2_BCL2L1-      ENFKKW-------------------LLAGMTLI--TG---VVVGSLI---
A0A3B3ZN55_BCL2L1-      ERFKKW-------------------LFAGMTLV--TG---VVVGSLL---
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      ESFKKW-------------------LLAGVTLV--TG---VVVGSLI---
A0A3Q3DUT7_BCL2L1-      ESFKKW-------------------LLAGVTLV--TG---VVVGSLI---
A0A3Q3DUT7_BCL2L1-      ESFKKW-------------------LLAGVTLV--TG---VVVGSLI---
A0A3B1JJ42_BCL2L1-      ERYKMW-------------------LLVGMTLF--TG---IVVGSLI---
A0A3P8UWG7_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3Q3IVF5_BCL2L1-      ESFKKW-------------------LLAGMTLV--TG---VVVGSLI---
A0A3Q1DHJ3_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVVGSLI---
A0A3Q1DHJ3_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVVGSLI---
A0A3Q1DHJ3_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVVGSLI---
A0A3P8TL99_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVVGSLI---
A0A3P8TL99_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVVGSLI---
A0A3Q1GS47_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVVGSLI---
A0A3B4Z3X2_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVVGSLI---
A0A3B4Z3X2_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVVGSLI---
C3VIT1_BCL2L1-01        ESFKKW-------------------LLVGMTVV--TG---VVVGSLF---
A0A3P8P0F1_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVAGALI---
A0A3Q2X557_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVAGALI---
A0A3P9D632_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVAGALI---
A0A3P9D632_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVAGALI---
A0A3Q4N4B5_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVAGALI---
A0A3B4FNX1_BCL2L1-      ESFKKW-------------------LLVGMTVV--TG---VVAGALI---
A0A3Q2QPL9_BCL2L1-      ESFKNW-------------------LLLGMSVV--TA---FIAGSIF---
A0A3B5PQJ0_BCL2L1-      ESFKNW-------------------LLLGMSVV--TA---FIAGSIF---
A0A087X9B7_BCL2L1-      ESFKNW-------------------LLLGMSVV--TA---FIAGSIF---
A0A3B3TUS7_BCL2L1-      ESFKNW-------------------LLLGMSVV--TA---FIAGSIF---
A0A3B3WI27_BCL2L1-      ESFKNW-------------------LLLGMSVV--TA---FIAGSIF---
A0A3P9N9Y4_BCL2L1-      ESFKNW-------------------LLLGMSVV--TA---FIAGSIF---
A0A3Q3BEB7_BCL2L1-      ESLKKW-------------------LLAGAALL--AG---LLLGVLV---
A0A3P8VMA1_BCL2L1-      DTVRRW-------------------LLVGAGLL--AA---VLIGVLI---
A0A345BSW9_BCL2L1-      -----------------------------LLAF--LS---YLVPFLQ---
A0A286MU87_BCL2L1-      ESIIKW-------------------LLVGVILL--SG---VLVGTLI---
A0A3P8XFS0_BCL2L1-      ESLRKW-------------------LLFG---------------------
A0A3P8XFS0_BCL2L1-      ESLRKW-------------------LLFGVMLL--SG---VLVGTLL---
A0A0F7L1T6_BCL2L1-      ENLSRW-------------------MLGGLALL--MG---VLVGAFI---
H2U5I3_BCL2L1-01        ENLSRW-------------------MLGGLALL--MG---VLVGAFI---
H2U5I3_BCL2L1-02        ENLSRW-------------------MLGGLALL--MG---VLVGAFI---
A0A3Q3J5K3_BCL2L1-      ETLRRW-------------------LLVGVVLL--TG---VLVGVLV---
A0A3Q1EVP6_BCL2L1-      DTLKRW-------------------LLAGGVLL--MG---VLAGVLI---
A0A3Q1BQA0_BCL2L1-      DTLKRW-------------------LLVGGVLL--MG---VLAGVLI---
A0A3P8U812_BCL2L1-      DTLKRW-------------------LLVGGVLL--MG---VLAGVLI---
E6ZFR0_BCL2L1-01        ETLSRW-------------------LLIGVALL--MG---AVVGVLI---
G3P7B4_BCL2L1-01        ETMRRW-------------------LLVGVALL--MG---VLVGMVM---
A0A3Q3X5M5_BCL2L1-      ETLNRW-------------------LLVGVALL--MG---VMVGVFI---
A0A2U9BIG9_BCL2L1-      ESVRRW-------------------LLVGVGML--TG---VLIAMFI---
Q6GLI5_BCL2L1-01        ERFGRW-------------------LMAIVTVT--AA---TLLVSYL---
Q2TAP5_BCL2L1-01        ERFGR--------------------LLTIVILT--GV---FALVCYM---
Q91828_BCL2L1-01        ERFGR--------------------LLTIVMLT--GV---FALVCYM---
I7GKS6_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K5EBP4_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K6UWY8_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A3Q1LRT3_BCL2L1-      ERFNCW------------------SLTTRLWLF--GI---FLIKHIF---
A0A2K5M8B1_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K5H963_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
G3RY91_BCL2L1-02        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K5VPG2_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
F6UKR4_BCL2L1-02        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K5YR37_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K6LPM4_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K6QFA2_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K6G3C5_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
H9GHK7_BCL2L1-01        ----------------------------------------QIISVIY---
Q07816_BCL2L1-04        -------------------------LPSTITIT--GRS------------
Q07817_BCL2L1-02        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K5YR37_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A452E1B1_BCL2L1-      EHFNRW-------------------SLTDVTVA--GM---ALLGLLF---
W5PSA5_BCL2L1-01        EHLNRW-------------------SLTDMTVA--GM---ALLGLLF---
Q07816_BCL2L1-01        ETFNKW-------------------LLTGATVA--GV---LLLGSLL---
Q07816_BCL2L1-03        ETFNKW-------------------LLTGATVA--GV---LLLGSLL---
Q07816_BCL2L1-02        ETFNKW-------------------LLTGATVA--GV---LLLGSLL---
G1N5N5_BCL2L1-01        ETFNKW-------------------LLTGATVA--GV---LLLGSLL---
A0A452ILL8_BCL2L1-      EQFNRW-------------------LLTGATLA--GV---LLLGSLL---
A0A452ILL8_BCL2L1-      EQFNRW-------------------LLTGATLA--GV---LLLGSLL---
K7F655_BCL2L1-01        EQFNRG-------------------LLTGATVA--GV---LLLGSLL---
A0A287CZ07_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
F6WA14_BCL2L1-01        ERFNRW-------------------LLTGMTVA--GV---VLLGSLF---
G3WKX6_BCL2L1-01        ERFNRW-------------------LLTGMTVA--GV---VLLGSLF---
F6WQI0_BCL2L1-02        SAF----------------------WADSRAPL--GTRGFSLALQEM---
G3SPN0_BCL2L1-01        VFIQVK------------------TYASGKLVQ--CF---LTLTQWF---
H0X6V2_BCL2L1-01        --------------------VCMCGNFCSLAAA--GR---CLTIGVM---
Q2PFS6_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
P53563_BCL2L1-02        PNCPFWSPGMVVEDIDYSGDIPGFTLIPGVNFG--NIDDPVFKEPVFFIL
P53563_BCL2L1-03        PNCPFWSPGMVVEDIDYSGDIPGFTLIPGVNFG--NIDDPVFKEPVFFIL
O35843_BCL2L1-01        TPLRSV-------------------FRRLVQVP--GVAEHVCDPSLW---
G1RER8_BCL2L1-01        ERFNRW-------------------FLTG---------------------
Q64373_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
Q64373_BCL2L1-09        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
P53563_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2U3V0P1_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---LLLGSLF---
O77737_BCL2L1-01        ERFNRW-------------------FLTGMTLA--GV---VLLGSLF---
Q9MYW4_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
F6WQI0_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
B2Z3Z4_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
Q05KJ0_BCL2L1-02        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
Q05KJ0_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
E2IV76_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K6G3C5_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
M3Z2H9_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A0D9RJZ8_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A286Y5D6_BCL2L1-      ERFNRW-------------------LLTGVTVA--GV---VLLGSLF---
A0A1L5BWY3_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
I3MUP5_BCL2L1-03        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
I3MUP5_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
I3MUP5_BCL2L1-02        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
G1P9D2_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K5EBP4_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
E2IV75_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
F7IT34_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
F7IT34_BCL2L1-02        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
Q76LT7_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K5M8B1_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K5H963_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
M3XA94_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
Q8SQ42_BCL2L1-01        ERSNRW-------------------FLTGMTVA--GV---VLLGSLF---
G3RY91_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
Q07817_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
Q07817_BCL2L1-03        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K5VPG2_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
F6UKR4_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K5YR37_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2J8VIH3_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K6LPM4_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K6QFA2_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K6QFA2_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A2K6UWY8_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
E2IV77_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A452SDS4_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A384D3U1_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
A0A452FWV3_BCL2L1-      ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
Q9MZS7_BCL2L1-01        ERFNRW-------------------FLTGMTVA--GV---VLLGSLF---
Q64373_BCL2L1-03        HP------------------------------------------------
Q64373_BCL2L1-04        HP------------------------------------------------
P53563_BCL2L1-04        IPNCPF-------------------WSPGMVVE--DI---DYSGDIP---
                                                                          

A0A3Q1GS47_BCL2L1-      --------------AQKRL--------------------------
R4JQR8_BCL2L1-01        --------------HRT----------------------------
A0A346RRN1_BCL2L1-      --------------QRV----------------------------
A0A452FIG6_BCL2L1-      --------------SKDTPWLT---------FPSPHAQAY-----
A0A452FIG6_BCL2L1-      --------------T--VPFITVIHVLHKLVFPS-FCYSYRDLTI
H3ANS8_BCL2L1-01        --------------FLRK---------------------------
H0Z8G3_BCL2L1-01        --------------SRK----------------------------
U3JSL7_BCL2L1-01        --------------SRK----------------------------
Q4U2V6_BCL2L1-01        --------------SRK----------------------------
A0A3B3ICL7_BCL2L1-      --------------TKKR---------------------------
A0A3B3E2W4_BCL2L1-      --------------AKKR---------------------------
A0A3B5B4X7_BCL2L1-      --------------AKKQ---------------------------
A0A3B4BFZ8_BCL2L1-      --------------AKK----------------------------
A0A3Q3FUB6_BCL2L1-      --------------AKKH---------------------------
A0A3B5MGS2_BCL2L1-      --------------AKKR---------------------------
M4A558_BCL2L1-01        --------------AKKR---------------------------
A0A3P9QFB3_BCL2L1-      --------------AKKR---------------------------
A0A087YBW4_BCL2L1-      --------------AKKR---------------------------
A0A3B3VWI7_BCL2L1-      --------------AKKR---------------------------
A0A3B3XN57_BCL2L1-      --------------AKKR---------------------------
A0A3Q2C6K4_BCL2L1-      --------------AKKR---------------------------
A0A3Q2NRP4_BCL2L1-      --------------AKKR---------------------------
A0A0B4KJI5_BCL2L1-      --------------AKKQ---------------------------
A0A3Q1JZ46_BCL2L1-      --------------AKKR---------------------------
A0A3Q1JZ46_BCL2L1-      --------------AKKR---------------------------
A0A3Q3NFM4_BCL2L1-      --------------AKKQ---------------------------
A0A3Q3NFM4_BCL2L1-      --------------AKKQ---------------------------
A0A3B4V9K8_BCL2L1-      --------------VKKH---------------------------
A0A3B4XS24_BCL2L1-      --------------VKKH---------------------------
C1BLI0_BCL2L1-01        --------------AKKHH--------------------------
C0HAD8_BCL2L1-01        --------------MKKRQ--------------------------
A0A3B3ZN55_BCL2L1-      --------------AQRRL--------------------------
A0A3B5K6B9_BCL2L1-      --------------VRKLL--------------------------
A0A3B5K6B9_BCL2L1-      --------------VRKLL--------------------------
H3CH49_BCL2L1-01        --------------VMR----------------------------
A0A3B3TFR4_BCL2L1-      --------------AKKRQ--------------------------
A0A3Q2FR43_BCL2L1-      --------------AHKRL--------------------------
A0A3P8XYL5_BCL2L1-      --------------AQKRL--------------------------
Q90Z98_BCL2L1-02        --------------AQKRL--------------------------
Q90Z98_BCL2L1-01        --------------AQKRL--------------------------
A0A059PJI5_BCL2L1-      --------------AQKRL--------------------------
A0A3B4DTL9_BCL2L1-      --------------AQKRL--------------------------
B5XAY3_BCL2L1-01        --------------AQKRL--------------------------
W5MG74_BCL2L1-01        --------------AKKRL--------------------------
A0A3Q3B3X5_BCL2L1-      --------------AQKRL--------------------------
A0A3B3IB64_BCL2L1-      --------------AQKRL--------------------------
A0A3P9JYH1_BCL2L1-      --------------AQKRL--------------------------
A0A3B3DHA1_BCL2L1-      --------------AQKRL--------------------------
A0A3Q0RTF8_BCL2L1-      --------------AQKRL--------------------------
I3IZK7_BCL2L1-01        --------------AQKRL--------------------------
A0A2U9BY16_BCL2L1-      --------------AQKRL--------------------------
A0A0D6DR75_BCL2L1-      --------------AQKRL--------------------------
A0A3Q3WIW8_BCL2L1-      --------------VQKRL--------------------------
A0A219P0Y3_BCL2L1-      --------------AQKRL--------------------------
A0A3Q3MX20_BCL2L1-      --------------AQKRL--------------------------
A0A3Q3G2E1_BCL2L1-      --------------AQKRL--------------------------
A0A3Q3G2E1_BCL2L1-      --------------AQKRL--------------------------
A0A3Q3G2E1_BCL2L1-      --------------AQKRL--------------------------
A0A3Q1GZ93_BCL2L1-      --------------AQKRL--------------------------
A0A3Q1GZ93_BCL2L1-      --------------AQKRL--------------------------
A0A3Q1GZ93_BCL2L1-      --------------AQKRL--------------------------
A0A3B4V3T1_BCL2L1-      --------------AQKRL--------------------------
A0A3B4XU17_BCL2L1-      --------------AQKRL--------------------------
D2ITA2_BCL2L1-02        --------------AKKHV--------------------------
A0A3B3ICL7_BCL2L1-      --------------TKKR---------------------------
A0A3B3QRZ2_BCL2L1-      --------------AQKRL--------------------------
A0A3B3ZN55_BCL2L1-      --------------AQRRL--------------------------
G3NJY1_BCL2L1-01        ---------------RSDI--------------------------
A0A3Q3DUT7_BCL2L1-      --------------AQKRL--------------------------
A0A3Q3DUT7_BCL2L1-      --------------AQKRL--------------------------
A0A3Q3DUT7_BCL2L1-      --------------AQKRL--------------------------
A0A3B1JJ42_BCL2L1-      --------------AQKRL--------------------------
A0A3P8UWG7_BCL2L1-      --------------AQKRL--------------------------
A0A3Q3IVF5_BCL2L1-      --------------IQKRL--------------------------
A0A3Q1DHJ3_BCL2L1-      --------------AQKRL--------------------------
A0A3Q1DHJ3_BCL2L1-      --------------AQKRL--------------------------
A0A3Q1DHJ3_BCL2L1-      --------------AQKRL--------------------------
A0A3P8TL99_BCL2L1-      --------------AQKRL--------------------------
A0A3P8TL99_BCL2L1-      --------------AQKRL--------------------------
A0A3Q1GS47_BCL2L1-      --------------AQKRL--------------------------
A0A3B4Z3X2_BCL2L1-      --------------AQKRL--------------------------
A0A3B4Z3X2_BCL2L1-      --------------AQKRL--------------------------
C3VIT1_BCL2L1-01        --------------AQKRL--------------------------
A0A3P8P0F1_BCL2L1-      --------------AQKRL--------------------------
A0A3Q2X557_BCL2L1-      --------------AQKRL--------------------------
A0A3P9D632_BCL2L1-      --------------AQKRL--------------------------
A0A3P9D632_BCL2L1-      --------------AQKRL--------------------------
A0A3Q4N4B5_BCL2L1-      --------------AQKRL--------------------------
A0A3B4FNX1_BCL2L1-      --------------AQKRL--------------------------
A0A3Q2QPL9_BCL2L1-      --------------VQKRL--------------------------
A0A3B5PQJ0_BCL2L1-      --------------AQKRL--------------------------
A0A087X9B7_BCL2L1-      --------------AQKRL--------------------------
A0A3B3TUS7_BCL2L1-      --------------AQKRL--------------------------
A0A3B3WI27_BCL2L1-      --------------AQKRL--------------------------
A0A3P9N9Y4_BCL2L1-      --------------AQKRL--------------------------
A0A3Q3BEB7_BCL2L1-      --------------AKKR---------------------------
A0A3P8VMA1_BCL2L1-      --------------TKKH---------------------------
A0A345BSW9_BCL2L1-      --------------FNHKEPL------------------------
A0A286MU87_BCL2L1-      --------------MKKRQ--------------------------
A0A3P8XFS0_BCL2L1-      --------------MENAQWT------------------------
A0A3P8XFS0_BCL2L1-      --------------MKKRQ--------------------------
A0A0F7L1T6_BCL2L1-      --------------VKKH---------------------------
H2U5I3_BCL2L1-01        --------------VKKH---------------------------
H2U5I3_BCL2L1-02        --------------VKKH---------------------------
A0A3Q3J5K3_BCL2L1-      --------------AKKL---------------------------
A0A3Q1EVP6_BCL2L1-      --------------AKKQ---------------------------
A0A3Q1BQA0_BCL2L1-      --------------AKKQ---------------------------
A0A3P8U812_BCL2L1-      --------------AKKQ---------------------------
E6ZFR0_BCL2L1-01        --------------AKKH---------------------------
G3P7B4_BCL2L1-01        --------------VKKR---------------------------
A0A3Q3X5M5_BCL2L1-      --------------AKKQ---------------------------
A0A2U9BIG9_BCL2L1-      --------------AKKQ---------------------------
Q6GLI5_BCL2L1-01        --------------RRR----------------------------
Q2TAP5_BCL2L1-01        --------------RRR----------------------------
Q91828_BCL2L1-01        --------------RRR----------------------------
I7GKS6_BCL2L1-01        --------------SRK----------------------------
A0A2K5EBP4_BCL2L1-      --------------SRK----------------------------
A0A2K6UWY8_BCL2L1-      --------------SRK----------------------------
A0A3Q1LRT3_BCL2L1-      --------------TKQPSNCTLEHLSGRYATLL-----------
A0A2K5M8B1_BCL2L1-      --------------SRK----------------------------
A0A2K5H963_BCL2L1-      --------------SRK----------------------------
G3RY91_BCL2L1-02        --------------SRK----------------------------
A0A2K5VPG2_BCL2L1-      --------------SRK----------------------------
F6UKR4_BCL2L1-02        --------------SRK----------------------------
A0A2K5YR37_BCL2L1-      --------------SRK----------------------------
A0A2K6LPM4_BCL2L1-      --------------SRK----------------------------
A0A2K6QFA2_BCL2L1-      --------------SRK----------------------------
A0A2K6G3C5_BCL2L1-      --------------SRK----------------------------
H9GHK7_BCL2L1-01        --------------THHSEVCLNTYID------------------
Q07816_BCL2L1-04        --------------PRSTELPSSRRQLLLS---------------
Q07817_BCL2L1-02        --------------SRK----------------------------
A0A2K5YR37_BCL2L1-      --------------SRK----------------------------
A0A452E1B1_BCL2L1-      --------------NT-----------------------------
W5PSA5_BCL2L1-01        --------------NCK----------------------------
Q07816_BCL2L1-01        --------------SRK----------------------------
Q07816_BCL2L1-03        --------------SRK----------------------------
Q07816_BCL2L1-02        --------------SRK----------------------------
G1N5N5_BCL2L1-01        --------------SRK----------------------------
A0A452ILL8_BCL2L1-      --------------SRK----------------------------
A0A452ILL8_BCL2L1-      --------------SRK----------------------------
K7F655_BCL2L1-01        --------------SRK----------------------------
A0A287CZ07_BCL2L1-      --------------SRK----------------------------
F6WA14_BCL2L1-01        --------------SRK----------------------------
G3WKX6_BCL2L1-01        --------------SRK----------------------------
F6WQI0_BCL2L1-02        --------------PLQ----------------------------
G3SPN0_BCL2L1-01        --------------TTQ----------------------------
H0X6V2_BCL2L1-01        --------------GYS----------------------------
Q2PFS6_BCL2L1-01        --------------SRK----------------------------
P53563_BCL2L1-02        ATLVAPQFHSFVPISRQRKTACVFTWLKT----------------
P53563_BCL2L1-03        ATLVAPQFHSFVPISRQRKTACVFTWLKT----------------
O35843_BCL2L1-01        --------------EVETEGSEVQGPPQLL---------------
G1RER8_BCL2L1-01        ---------------------------------------------
Q64373_BCL2L1-01        --------------SRK----------------------------
Q64373_BCL2L1-09        --------------SRK----------------------------
P53563_BCL2L1-01        --------------SRK----------------------------
A0A2U3V0P1_BCL2L1-      --------------SRK----------------------------
O77737_BCL2L1-01        --------------SRK----------------------------
Q9MYW4_BCL2L1-01        --------------SRK----------------------------
F6WQI0_BCL2L1-01        --------------SRK----------------------------
B2Z3Z4_BCL2L1-01        --------------SRK----------------------------
Q05KJ0_BCL2L1-02        --------------SRK----------------------------
Q05KJ0_BCL2L1-01        --------------SRK----------------------------
E2IV76_BCL2L1-01        --------------SRK----------------------------
A0A2K6G3C5_BCL2L1-      --------------SRK----------------------------
M3Z2H9_BCL2L1-01        --------------SRK----------------------------
A0A0D9RJZ8_BCL2L1-      --------------SRK----------------------------
A0A286Y5D6_BCL2L1-      --------------SRK----------------------------
A0A1L5BWY3_BCL2L1-      --------------SRK----------------------------
I3MUP5_BCL2L1-03        --------------SRK----------------------------
I3MUP5_BCL2L1-01        --------------SRK----------------------------
I3MUP5_BCL2L1-02        --------------SRK----------------------------
G1P9D2_BCL2L1-01        --------------SRK----------------------------
A0A2K5EBP4_BCL2L1-      --------------SRK----------------------------
E2IV75_BCL2L1-01        --------------SRK----------------------------
F7IT34_BCL2L1-01        --------------SRK----------------------------
F7IT34_BCL2L1-02        --------------SRK----------------------------
Q76LT7_BCL2L1-01        --------------SRK----------------------------
A0A2K5M8B1_BCL2L1-      --------------SRK----------------------------
A0A2K5H963_BCL2L1-      --------------SRK----------------------------
M3XA94_BCL2L1-01        --------------SRK----------------------------
Q8SQ42_BCL2L1-01        --------------SRK----------------------------
G3RY91_BCL2L1-01        --------------SRK----------------------------
Q07817_BCL2L1-01        --------------SRK----------------------------
Q07817_BCL2L1-03        --------------SRK----------------------------
A0A2K5VPG2_BCL2L1-      --------------SRK----------------------------
F6UKR4_BCL2L1-01        --------------SRK----------------------------
A0A2K5YR37_BCL2L1-      --------------SRK----------------------------
A0A2J8VIH3_BCL2L1-      --------------SRK----------------------------
A0A2K6LPM4_BCL2L1-      --------------SRK----------------------------
A0A2K6QFA2_BCL2L1-      --------------SRK----------------------------
A0A2K6QFA2_BCL2L1-      --------------SRK----------------------------
A0A2K6UWY8_BCL2L1-      --------------SRK----------------------------
E2IV77_BCL2L1-01        --------------SRK----------------------------
A0A452SDS4_BCL2L1-      --------------SRK----------------------------
A0A384D3U1_BCL2L1-      --------------SRK----------------------------
A0A452FWV3_BCL2L1-      --------------SRK----------------------------
Q9MZS7_BCL2L1-01        --------------SRK----------------------------
Q64373_BCL2L1-03        ---------------------------------------------
Q64373_BCL2L1-04        ---------------------------------------------
P53563_BCL2L1-04        --------------GSL----------------------------
                                                                     

© 1998-2019