Dataset for protein Bfl1 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

82 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3T6T8_BCL2A1-      --------------------------------------------------
U3JTB2_BCL2A1-01        -----------------------------------------METAEFYYV
H0ZCL9_BCL2A1-01        -----------------------------------------METAEFYYV
Q9W6F2_BCL2A1-01        -----------------------------------------METAEFYYV
G1N8C5_BCL2A1-01        -----------------------------------------METAEFYYV
A0A452J3N6_BCL2A1-      -----------------------------------------MESSEYCYV
K7G130_BCL2A1-01        -----------------------------------------MESSEFRYV
F6SFL4_BCL2A1-01        -----------------------------------------MDDYEFHYV
G3WSP8_BCL2A1-01        -----------------------------------------MADCEFHYV
F6S8G3_BCL2A1-01        -----------------------------------------MDDGVFWSV
G1T1L8_BCL2A1-01        -----------------MFASQGFGSFQKKQSPALLSEQQKMSDCEFGYV
O55178_BCL2A1-01        -----------------------------------------MAEYELMHI
Q0P538_BCL2A1-01        -----------------------------------------MAEYELMHI
A0A337STN9_BCL2A1-      -----------------------------------------MADGEFGYV
A0A337STN9_BCL2A1-      -----------------------------------------MADGEFGYV
E2RS00_BCL2A1-01        -----------------------------------------MTDCEFGYT
M3YVH4_BCL2A1-01        -----------------------------------------MTDSEFGYT
A0A452SIR9_BCL2A1-      -----------------------------------------MTDCEFGYT
G3V977_BCL2A1-01        -----------------------------------------MTDCEFMYI
Q925A9_BCL2A1-01        -----------------------------------------MTDCEFMYI
Q07440_BCL2A1-01        -----------------------------------------MAESELMHI
O55179_BCL2A1-01        -----------------------------------------MSEYEFMYI
O55177_BCL2A1-02        -----------------------------------------MAEYEFMYI
Q497M6_BCL2A1-01        -----------------------------------------MAEYEFMYI
Q8K164_BCL2A1-01        -----------------------------------------MAEYEFMYI
Q4FK02_BCL2A1-01        -----------------------------------------MSEYEFMYI
I3MCZ7_BCL2A1-01        -----------------------------------------MNDCEFRFI
G3T8E6_BCL2A1-01        -----------------------------------------MTDCEFGYI
H0WZ23_BCL2A1-01        -----------------------------------------MTDCEFGYI
A0A2K6TLM0_BCL2A1-      -----------------------------------------MTDHEFGYI
A0A2K5D2I1_BCL2A1-      -----------------------------------------MTDCEFGYI
U3DBA0_BCL2A1-02        -----------------------------------------MTDSEFGYI
A0A2K6TLM0_BCL2A1-      -----------------------------------------MTDHEFGYI
B4E1X9_BCL2A1-01        -----------------------------------------MTDCEFGYI
Q16548_BCL2A1-02        -----------------------------------------MTDCEFGYI
A0A2I2YML2_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2R8ZJX9_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2I3T6T8_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2I3HNF3_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K6PHG5_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K6LV22_BCL2A1-      -----------------------------------------MTDCEFGYI
F7E8V5_BCL2A1-02        -----------------------------------------MTDCEFGYI
A0A2K5KHH9_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K6AD55_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K5TMD8_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K5KAB6_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K6DS80_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A096NMX5_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K6EKG1_BCL2A1-      -----------------------------------------MTDCEFGYT
Q3C2I0_BCL2A1-01        -----------------------------------------MTDTEFGYV
A0A452EK63_BCL2A1-      -----------------------------------------MTDTEFDYV
W5Q0N6_BCL2A1-01        -----------------------------------------MTDTEFDYV
F7CP56_BCL2A1-01        -----------------------------------------MTDCEFGYI
C7F841_BCL2A1-02        -----------------------------------------MTDDEFGYI
C7F841_BCL2A1-01        -----------------------------------------MTDDEFGYI
A0A2I3HNF3_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2I2YML2_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2R8ZJX9_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2I3T6T8_BCL2A1-      -----------------------------------------MTDCEFGYI
H2NNZ9_BCL2A1-01        -----------------------------------------MTDCEFGYI
Q16548_BCL2A1-01        -----------------------------------------MTDCEFGYI
A0A2I2YML2_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K6LV22_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K6PHG5_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2R8ZJX9_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2I3T6T8_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2I3HNF3_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K5KHH9_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K5KHH9_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K5KAB6_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K5TMD8_BCL2A1-      -----------------------------------------MTDCEFGYI
F7E8V5_BCL2A1-01        -----------------------------------------MTDCEFGYI
A0A2K6DS80_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K6AD55_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A096NMX5_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A0D9RRC3_BCL2A1-      -----------------------------------------MTDCEFGYI
A0A2K5D2I1_BCL2A1-      -----------------------------------------MTDCEFGYI
U3DBA0_BCL2A1-01        -----------------------------------------MTDSEFGYI
A0A2K6TLM0_BCL2A1-      -----------------------------------------MTDHEFGYI
A0A286XUI2_BCL2A1-      MGHILLSATAGSLDLREPAAGCCL--------------PPRMIDLEFRYT
A0A452U2H8_BCL2A1-      MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYT
A0A452U2H8_BCL2A1-      MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYT
                                                                          

A0A2I3T6T8_BCL2A1-      --------------------------------------------------
U3JTB2_BCL2A1-01        YYLAQDYLQYVLQESHLGPAQTRVAHVLRTMASSLQDQTEEALRPLLDRI
H0ZCL9_BCL2A1-01        YYLAQDYLQYVLQESHLGPAQTRVAHVLRTMASSLQDQTEEAVRPLLDRI
Q9W6F2_BCL2A1-01        YYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRI
G1N8C5_BCL2A1-01        YYLAQDYLQYVLQESRLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRI
A0A452J3N6_BCL2A1-      YYLVQDYLKYVLQEPQLGPAPSRVAHVLRHAASFLQKENEESLKPCLDTF
K7G130_BCL2A1-01        YYLVQDYLKYILQEPELGPAPSRVAHVLRNSASFLQKENEEILKPCLDTL
F6SFL4_BCL2A1-01        HMLARDYLKHVQQTPPLGSCLNKTSQILQKVAFSVQQEVEKDMETCLSTL
G3WSP8_BCL2A1-01        HMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEKDMETFLSTL
F6S8G3_BCL2A1-01        RALALDYLDDVLQTPRLGTVPSRTSRALQNVMFSVQGDVEKALKPCFDSL
G1T1L8_BCL2A1-01        HTLAQDYLLYILKTPQPGLGPSKTSRVLQNVTFSIQQEVEEALQPYLHNV
O55178_BCL2A1-01        HSLAEHYLQYVLQVPAFESAPSQAFRVLQRVAFSVQKEVGKNLKSYLDDF
Q0P538_BCL2A1-01        HSLAEHYLQYVLQVPAFESAPSQAFRVLQRVAFSVQKEVGKNLKSYLDDF
A0A337STN9_BCL2A1-      LTLARDYTEHVLQGPQPGSHPSRVSQVLQDVAFSVQGEVEKKLKPCLDKF
A0A337STN9_BCL2A1-      LTLARDYTEHVLQGPQPGSHPSRVSQVLQDVAFSVQGEVEKKLKPCLDKF
E2RS00_BCL2A1-01        LALAQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSF
M3YVH4_BCL2A1-01        LSLAQDYVRHVLQIPQPSPAASRVSRVLRDVASSVQGEVEQNLRPCLDSF
A0A452SIR9_BCL2A1-      LTLAQDYVKHVLQIPQPGSAPSRASQVLRDVASSVQGEVEKNLKPCLDSF
G3V977_BCL2A1-01        HSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDF
Q925A9_BCL2A1-01        HSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDF
Q07440_BCL2A1-01        HSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDF
O55179_BCL2A1-01        HSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDF
O55177_BCL2A1-02        HSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDF
Q497M6_BCL2A1-01        HSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDF
Q8K164_BCL2A1-01        HSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDF
Q4FK02_BCL2A1-01        HSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDF
I3MCZ7_BCL2A1-01        HTLAQDYLQHVLQVPQRGSSPSKTSKVLQNVAFSVQKEVEKNLKPFLDNF
G3T8E6_BCL2A1-01        YKLVQDYLKYVLQIPQPAAGSSKTSRVLQNVAFSVQKEVEKNLKPCLDNF
H0WZ23_BCL2A1-01        HRLAQDYLQYVLQIQQCGSGPSKTSRVLQNVAFSVQEEVEKSLKPCLDNF
A0A2K6TLM0_BCL2A1-      HNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNV
A0A2K5D2I1_BCL2A1-      HNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNV
U3DBA0_BCL2A1-02        HNLTQDYLQYVLQIPQSGMGPSKTSRVLQQVAFSVQKEVEKSLKSCLDNV
A0A2K6TLM0_BCL2A1-      HNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNV
B4E1X9_BCL2A1-01        YRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNV
Q16548_BCL2A1-02        YRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNV
A0A2I2YML2_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNV
A0A2R8ZJX9_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSQTSRVLQNVAFSVQKEVEKNLKSCLDNV
A0A2I3T6T8_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNV
A0A2I3HNF3_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNV
A0A2K6PHG5_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K6LV22_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
F7E8V5_BCL2A1-02        YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K5KHH9_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K6AD55_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K5TMD8_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K5KAB6_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQEEVEKNLKPCLDNV
A0A2K6DS80_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A096NMX5_BCL2A1-      YRLAQDYLQYVLQIPQPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K6EKG1_BCL2A1-      HRLVQDYLQYVLRVPQPGSGPSKTSRVLQNIAFSVQNEVEKNLKACLDNV
Q3C2I0_BCL2A1-01        HGLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKF
A0A452EK63_BCL2A1-      HKLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKF
W5Q0N6_BCL2A1-01        HKLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKF
F7CP56_BCL2A1-01        HMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPCLDNF
C7F841_BCL2A1-02        HMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEKNLKPCLDNF
C7F841_BCL2A1-01        HMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEKNLKPCLDNF
A0A2I3HNF3_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNV
A0A2I2YML2_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNV
A0A2R8ZJX9_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSQTSRVLQNVAFSVQKEVEKNLKSCLDNV
A0A2I3T6T8_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNV
H2NNZ9_BCL2A1-01        YRLAQDYLQYVLQIPQPGSGPSKASRVLQKVAFSVQKEVEKNLKPCLDNV
Q16548_BCL2A1-01        YRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNV
A0A2I2YML2_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNV
A0A2K6LV22_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K6PHG5_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2R8ZJX9_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSQTSRVLQNVAFSVQKEVEKNLKSCLDNV
A0A2I3T6T8_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNV
A0A2I3HNF3_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNV
A0A2K5KHH9_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K5KHH9_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K5KAB6_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQEEVEKNLKPCLDNV
A0A2K5TMD8_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
F7E8V5_BCL2A1-01        YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K6DS80_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A2K6AD55_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A096NMX5_BCL2A1-      YRLAQDYLQYVLQIPQPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNV
A0A0D9RRC3_BCL2A1-      YRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVASSVQKEVEKNLKPCLDNV
A0A2K5D2I1_BCL2A1-      HNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNV
U3DBA0_BCL2A1-01        HNLTQDYLQYVLQIPQSGMGPSKTSRVLQQVAFSVQKEVEKSLKSCLDNV
A0A2K6TLM0_BCL2A1-      HNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNV
A0A286XUI2_BCL2A1-      QALAQDYLLHVLQVPQCETSPSKASKVLQDMALSVQEEVERRLKPWLDRI
A0A452U2H8_BCL2A1-      LTLAQDYVKHVLQIPQPGSAPSRASQVLRDVASSVQGEVEKNLKPCLDSF
A0A452U2H8_BCL2A1-      LTLAQDYVKHVLQIPQPGSAPSRASQVLRDVASSVQGEVEKNLKPCLDSF
                                                                          

A0A2I3T6T8_BCL2A1-      ------VARSWLTAASTSTAQE----------------------------
U3JTB2_BCL2A1-01        DITSVAVAKRIFNGVMDEKFADGNTNWGRIMTIFTFGGLLTKKLQEHGVQ
H0ZCL9_BCL2A1-01        DITSVAAAKRIFNGVMDEKFADGNTNWGRIMTIFTFGGLLTKKLQEHGVQ
Q9W6F2_BCL2A1-01        DITSVDVAKRIFNGVMEEKFADGNTNWGRIMTIFTFGGLLTKKLQEHGVQ
G1N8C5_BCL2A1-01        DITSVDVAKRIFNGVMEEKFADGNTNWGRIMTIFTFGGLLTKKLQEQGVQ
A0A452J3N6_BCL2A1-      DITSVDAARRIFTQVMDKEFADGNTNWGRILTIFMFGGILSKKLQEHRVQ
K7G130_BCL2A1-01        DITSVDAARRIFIQVMDKEFDDGNTNWGRILTIFMFGGILSKRLQEHKVQ
F6SFL4_BCL2A1-01        DIVSVESARRIFNSVMKKEFEDGVINWGRIVTIFAFGGILIKKLLRHRAP
G3WSP8_BCL2A1-01        DITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILIKKLLRHRAP
F6S8G3_BCL2A1-01        DVGSVGAARRIFGQIVEKEFEDGIVNWGRIVTIFVLGGILTKKLQRSGVP
G1T1L8_BCL2A1-01        PVASVETARTIFNQVMEKEFEDGVINWGRIVTIFAFEGVLAKKLLQEQAV
O55178_BCL2A1-01        HVESIDTTRIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKTSTRADC
Q0P538_BCL2A1-01        HVESIDTTRIIFNQVMEKEFENGIINWGRIVTIFAFGGVLLKKTSTRADC
A0A337STN9_BCL2A1-      HVVSVDTARTIFHQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLQERIV
A0A337STN9_BCL2A1-      HVVSVDTARTIFHQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLQERIV
E2RS00_BCL2A1-01        DVVSVDTARTIFNQVMEKEFEDGVINWGRIVTVFAFEGILTKKLLEQRIS
M3YVH4_BCL2A1-01        DVGSIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFEGILSKKLLRERIS
A0A452SIR9_BCL2A1-      DVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERIS
G3V977_BCL2A1-01        HVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIA
Q925A9_BCL2A1-01        HVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIG
Q07440_BCL2A1-01        HVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIA
O55179_BCL2A1-01        HVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIA
O55177_BCL2A1-02        HVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIA
Q497M6_BCL2A1-01        HVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIA
Q8K164_BCL2A1-01        HVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIA
Q4FK02_BCL2A1-01        HVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIA
I3MCZ7_BCL2A1-01        DVVSADTARTIFNQVMEKEFEDGIMNWGRIVTIFAFGGVLVKKLLRERIA
G3T8E6_BCL2A1-01        VVISIDTAQTIFKQVMEKEFEDGIINWGRIVTIFAFGGILIKKLLRERIA
H0WZ23_BCL2A1-01        NVVSIDTARTIFNQVMEKEFEDGIINWGRIVTIFAFGGILLKKLLQQRIA
A0A2K6TLM0_BCL2A1-      HIVSMDNARTIFSQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRERIA
A0A2K5D2I1_BCL2A1-      NIVSIDNARMIFSQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRERIA
U3DBA0_BCL2A1-02        DIASIDNARTIFSQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRERIA
A0A2K6TLM0_BCL2A1-      HIVSMDNARTIFSQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRERIA
B4E1X9_BCL2A1-01        NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
Q16548_BCL2A1-02        NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2I2YML2_BCL2A1-      NVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2R8ZJX9_BCL2A1-      NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2I3T6T8_BCL2A1-      NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2I3HNF3_BCL2A1-      NVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILVKKLLRQRTA
A0A2K6PHG5_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2K6LV22_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
F7E8V5_BCL2A1-02        NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K5KHH9_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K6AD55_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K5TMD8_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K5KAB6_BCL2A1-      NVASIDTARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K6DS80_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A096NMX5_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K6EKG1_BCL2A1-      NVASIDAARTIFNQVMEKEFEDGIVNWGRIVTVFAFGGILIKKLLREQIA
Q3C2I0_BCL2A1-01        DVVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILTKKLLGKCIA
A0A452EK63_BCL2A1-      DVVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILTKKLLSKRIA
W5Q0N6_BCL2A1-01        DVVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILTKKLLSKRIA
F7CP56_BCL2A1-01        HVVSIDAARTIFNQVMEKQFEDGIINWGRIMTIFAFEGILIKKLLPERIA
C7F841_BCL2A1-02        DVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILMKKLLRKRIA
C7F841_BCL2A1-01        DVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILMKKLLRKRIA
A0A2I3HNF3_BCL2A1-      NVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILVKKLLRQRTA
A0A2I2YML2_BCL2A1-      NVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2R8ZJX9_BCL2A1-      NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2I3T6T8_BCL2A1-      NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
H2NNZ9_BCL2A1-01        NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
Q16548_BCL2A1-01        NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2I2YML2_BCL2A1-      NVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2K6LV22_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2K6PHG5_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2R8ZJX9_BCL2A1-      NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2I3T6T8_BCL2A1-      NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIA
A0A2I3HNF3_BCL2A1-      NVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILVKKLLRQRTA
A0A2K5KHH9_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K5KHH9_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K5KAB6_BCL2A1-      NVASIDTARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K5TMD8_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
F7E8V5_BCL2A1-01        NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K6DS80_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K6AD55_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A096NMX5_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A0D9RRC3_BCL2A1-      NVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIA
A0A2K5D2I1_BCL2A1-      NIVSIDNARMIFSQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRERIA
U3DBA0_BCL2A1-01        DIASIDNARTIFSQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRERIA
A0A2K6TLM0_BCL2A1-      HIVSMDNARTIFSQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRERIA
A0A286XUI2_BCL2A1-      DVESIDTAKSIFNQVMEKEFEDGIINWGRIVTIFAFGGVILKKLPREPIA
A0A452U2H8_BCL2A1-      DVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERIS
A0A452U2H8_BCL2A1-      DVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERIS
                               :.  :     .   :                            

A0A2I3T6T8_BCL2A1-      ------------------------------------NGFVKKFEHKSG--
U3JTB2_BCL2A1-01        LTAEEKEEISYFITEYIINNKSEWIDANGGWE----NGFLTKF-ERRS--
H0ZCL9_BCL2A1-01        LTAEEKEQISYFITEYIINNKAEWIDANGGWE----NGFLTKF-ERRS--
Q9W6F2_BCL2A1-01        LTGEEKEKISYFITEYIINNKAAWIDANGGWE----NGFLTKF-ERRS--
G1N8C5_BCL2A1-01        LTGEEKEQISYFITEYIINNKAAWIDANGGWE----NGFLTKF-ERRS--
A0A452J3N6_BCL2A1-      LTGENKKQISYFITEYIINTKAEWIEANGGWE----NGFLTMFEEKRS--
K7G130_BCL2A1-01        LTGDNKEQISYFITEYIINTKAEWIDANGGWE----NGFLPMFEEKQS--
F6SFL4_BCL2A1-01        LTMGTQEEISHFIAEFIMNNIAEWIRQNGGWE----NGFVKNFEPNTV--
G3WSP8_BCL2A1-01        LTMDTHEEISHFIAEFIMNNIAEWIRQNGGWE----NGFIKNFEPNMV--
F6S8G3_BCL2A1-01        LTRETREEISCFIAEFTTHHAGEWIRQNGGWE----NGFLNKFEQKTV--
G1T1L8_BCL2A1-01        PDVDTFKSIPYFVAEFITRRMGEWIRQNGGWE----NGFVKKFEHNSG--
O55178_BCL2A1-01        PGCTCLQTSFQF--------------------------------------
Q0P538_BCL2A1-01        PGCTCLQTSFQF--------------------------------------
A0A337STN9_BCL2A1-      PDADAFK-VSYFVAEFITKHTGEWIRQNGGWH----SVQV----------
A0A337STN9_BCL2A1-      PDADAFK-VSYFVAEFITKHTGEWIRQNGGWE----NGFVRKFEPKSG--
E2RS00_BCL2A1-01        SDVDAEK-VSYFVAEFITRNMRDWIRQNGGWE----NGFVKKFEPKSG--
M3YVH4_BCL2A1-01        PDVDASR-VSYFVAEFITTNMREWIRQNGGWE----DGFVKKFEPKSG--
A0A452SIR9_BCL2A1-      PDVDASR-ISYFVAEFITTNMREWIRQNGGWE----DGFVKKFEPKSG--
G3V977_BCL2A1-01        LDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWE----DGFTKKFEPKSG--
Q925A9_BCL2A1-01        LDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWE----DGFTKKFEPKSG--
Q07440_BCL2A1-01        LDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWE----DGFIKKFEPKSG--
O55179_BCL2A1-01        LDVGAYKQVSSFVAEFIMNNTGEWIRRNGGWE----DGFIKKFEPKSG--
O55177_BCL2A1-02        LDVGAYKQVSSFVAEFIINNTGEWIRRNGGWE----DGFIKKFEPKSG--
Q497M6_BCL2A1-01        LDVGAYKQVSSFVAEFIINNTGEWIRRNGGWE----DGFIKKFEPKSG--
Q8K164_BCL2A1-01        LDVGAYKQVSSFVAEFIINNTGEWIRRNGGWE----DGFIKKFEPKSG--
Q4FK02_BCL2A1-01        LDVGAYKQVSSFVAEFIINNTGEWIRRNGGWE----DGFIKKFEPKSG--
I3MCZ7_BCL2A1-01        PAVDSDEEISYFVAEFIMNNAGEWIRQNGGWE----NGFVKKFEPKSG--
G3T8E6_BCL2A1-01        PDVDTYKKISSFVAEFIVDNTAEWIRQNGGWE----NGFVKKFEPRSG--
H0WZ23_BCL2A1-01        LDVDTYKEISYFVAEFIMNYTGEWIRQNGGWE----HGFVKKFEPNSGYS
A0A2K6TLM0_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRRNGGWD----LSQ-----------
A0A2K5D2I1_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWISQNGGWA----K-------------
U3DBA0_BCL2A1-02        PDVDTYKEISHFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2K6TLM0_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRRNGGWG----K-------------
B4E1X9_BCL2A1-01        PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWV----C-------------
Q16548_BCL2A1-02        PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2I2YML2_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2R8ZJX9_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2I3T6T8_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2I3HNF3_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2K6PHG5_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2K6LV22_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
F7E8V5_BCL2A1-02        PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2K5KHH9_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2K6AD55_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2K5TMD8_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2K5KAB6_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2K6DS80_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A096NMX5_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG----K-------------
A0A2K6EKG1_BCL2A1-      LDVDTYKEISYFIAEFITNNAGEWIRQNGGWE----HGFVKKFEPRPA--
Q3C2I0_BCL2A1-01        SDMDMCKDISFFVAEFITENTGEWIKQNGGWE----NGFVKKFETKSG--
A0A452EK63_BCL2A1-      SDMDMCKDISYFVAEFITENTGEWIRQNGGWE----NGFVKKFETKSG--
W5Q0N6_BCL2A1-01        SDMDMCKDISYFVAEFITKNTGEWIRQNGGWE----NGFVKKFETKSG--
F7CP56_BCL2A1-01        PDVDTYKEISYFVAEFITKNTGEWIRQNGGWE----NGFVKKFEPKSG--
C7F841_BCL2A1-02        PDVDTYKEISYFVAEFITKNTGQWIRQNGGWE----NGFVKKFEPKSG--
C7F841_BCL2A1-01        PDVDTYKEISYFVAEFITKNTGQWIRQNGGWE----NGFVKKFEPKSG--
A0A2I3HNF3_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2I2YML2_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2R8ZJX9_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEHKSG--
A0A2I3T6T8_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEHKSG--
H2NNZ9_BCL2A1-01        PDVDTYKEISYFVAEFVMNNTGGWIKQNGGWE----NGFVKKLEPKSG--
Q16548_BCL2A1-01        PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2I2YML2_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2K6LV22_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2K6PHG5_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2R8ZJX9_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEHKSG--
A0A2I3T6T8_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEHKSG--
A0A2I3HNF3_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2K5KHH9_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2K5KHH9_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKLEPKSG--
A0A2K5KAB6_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2K5TMD8_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
F7E8V5_BCL2A1-01        PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2K6DS80_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2K6AD55_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A096NMX5_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A0D9RRC3_BCL2A1-      PDVDTYKEISYFVAEFITNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2K5D2I1_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWISQNGGWE----NGFVKKFEPKSG--
U3DBA0_BCL2A1-01        PDVDTYKEISHFVAEFIMNNTGEWIRQNGGWE----NGFVKKFEPKSG--
A0A2K6TLM0_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRRNGGWE----NGFVKKFEPKSG--
A0A286XUI2_BCL2A1-      PDVDTYKEISYFVAEFIMSRMGGWIRQNGGWD----NGFVRKFEPKSG--
A0A452U2H8_BCL2A1-      PDVDASR-ISYFVAEFITTNMREWIRQNGGWSLLPPSASVKGCKRRAP--
A0A452U2H8_BCL2A1-      PDVDASR-ISYFVAEFITTNMREWIRQNGGWE----DGFVKKFEPKSG--
                                                                          

A0A2I3T6T8_BCL2A1-      -WMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF------
U3JTB2_BCL2A1-01        -LLSFSKITALFIAVVSLFREYY---------------------------
H0ZCL9_BCL2A1-01        -LLSFSKITALFIALVSLFREYY---------------------------
Q9W6F2_BCL2A1-01        -PLSFSTITDIFAAVLSLFREYH---------------------------
G1N8C5_BCL2A1-01        -PLSFSTITDIFAAVFSLFRDYY---------------------------
A0A452J3N6_BCL2A1-      -WLSLFNIKAKIMDAFSFFSQYY---------------------------
K7G130_BCL2A1-01        -WLSLFNIKAKIMDAFSFFSQYY---------------------------
F6SFL4_BCL2A1-01        -WPNFTDISTKIWGIFSFLK------------------------------
G3WSP8_BCL2A1-01        -WPNFTDISTKIWNVFSFLK------------------------------
F6S8G3_BCL2A1-01        -WSVLADISMKILGVLSHLKQFY---------------------------
G1T1L8_BCL2A1-01        -WKIFLEVAKQICVILSLLKK-YC--------------------------
O55178_BCL2A1-01        -WGRIHNE------------------------------------------
Q0P538_BCL2A1-01        -WGRIHHE------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      -WLTFLEVTGKICKVLSLLKNYY---------------------------
E2RS00_BCL2A1-01        -WLTFLEVLGTVCEMWSHLKQYY---------------------------
M3YVH4_BCL2A1-01        -WLTFLEVIGKICEMFSLLKQYY---------------------------
A0A452SIR9_BCL2A1-      -WLTFLEVTGKICEMFSLLKQYY---------------------------
G3V977_BCL2A1-01        -WLTFLQMTGKIWEMLFLLKQHY---------------------------
Q925A9_BCL2A1-01        -WLTFLQMTGKIWEMLFLLKQHY---------------------------
Q07440_BCL2A1-01        -WLTFLQMTGQIWEMLFLLK------------------------------
O55179_BCL2A1-01        -WLTFLQMTGQIWEMLFLLK------------------------------
O55177_BCL2A1-02        -WLTFLQMTGQFWEMLFLLK------------------------------
Q497M6_BCL2A1-01        -WLTFLQMTGQFWEMLFLLK------------------------------
Q8K164_BCL2A1-01        -WLTFLQMTGQIWEMLFLLK------------------------------
Q4FK02_BCL2A1-01        -WLTFLQMTGQFWEMLFLLK------------------------------
I3MCZ7_BCL2A1-01        -WLTFLGVTGQICEMLSLLKQYY---------------------------
G3T8E6_BCL2A1-01        -WLTFLEVTGKICEMLFLLKQYY---------------------------
H0WZ23_BCL2A1-01        GWLTFLEVTRKICEMLPLL-------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      -WHSLLLV---LVESVAQKERKMAL-------------------------
U3DBA0_BCL2A1-02        -WHSLMLM---LVS-VAQKKRKMAL-------------------------
A0A2K6TLM0_BCL2A1-      -WNSLMLM---LVE-SAQKKKKMAL-------------------------
B4E1X9_BCL2A1-01        -VMEKFFI---VLSCEIEIENFLAS-------------------------
Q16548_BCL2A1-02        -WHNHTPM---LVESVAHKKRKMAL-------------------------
A0A2I2YML2_BCL2A1-      -WHNHTPM---LVESVAHKKRKMAL-------------------------
A0A2R8ZJX9_BCL2A1-      -WHNHTPM---LVESVAHKKRKMAL-------------------------
A0A2I3T6T8_BCL2A1-      -WHNHTPM---LVESVAHKKRKMAL-------------------------
A0A2I3HNF3_BCL2A1-      -WHNHMPM---LVESVAHKKRKMAL-------------------------
A0A2K6PHG5_BCL2A1-      -WHNHMPM---LVESVAHKKKKMAL-------------------------
A0A2K6LV22_BCL2A1-      -WHNHMPM---LVESVAHRKKKMAL-------------------------
F7E8V5_BCL2A1-02        -WHNHMPM---LVESVAH--------------------------------
A0A2K5KHH9_BCL2A1-      -WHNHMPM---LVESVAHRKKKMAL-------------------------
A0A2K6AD55_BCL2A1-      -WHNHMPM---LVESVAHRKKKMAL-------------------------
A0A2K5TMD8_BCL2A1-      -WHNHMPM---LVESVAH-KKKMAL-------------------------
A0A2K5KAB6_BCL2A1-      -WHNHMPM---LVESVAHKKKKMAL-------------------------
A0A2K6DS80_BCL2A1-      -WHNHMPM---LVESVAHKKKKMAL-------------------------
A0A096NMX5_BCL2A1-      -WHNHMPM---LVESVAHKKKKMAL-------------------------
A0A2K6EKG1_BCL2A1-      -WLTFLEVTGKICDMLSLL---YS--------------------------
Q3C2I0_BCL2A1-01        -WLTFLEVTGKICETLCRLKQ-YY--------------------------
A0A452EK63_BCL2A1-      -WLTFLEVTGKICETLCRLKQ-YY--------------------------
W5Q0N6_BCL2A1-01        -WLTFLEVTGKICETLCRLKQ-YY--------------------------
F7CP56_BCL2A1-01        -WLTFLEVTGKMCEIL-FLKQ-YY--------------------------
C7F841_BCL2A1-02        -WLTFVEVTGKICEMLCLLKQ-YY--------------------------
C7F841_BCL2A1-01        -WLTFVEVTGKICEMLCLLKQ-YY--------------------------
A0A2I3HNF3_BCL2A1-      -WMTFLEVTGKISILLTRKDTPYCETGLIFLTLMETIANTYFYFKINNFD
A0A2I2YML2_BCL2A1-      -WMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF------
A0A2R8ZJX9_BCL2A1-      -WMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF------
A0A2I3T6T8_BCL2A1-      -WMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF------
H2NNZ9_BCL2A1-01        -WMTF-EVTGKICEMLSLLKQ-YC--------------------------
Q16548_BCL2A1-01        -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2I2YML2_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2K6LV22_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2K6PHG5_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2R8ZJX9_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2I3T6T8_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2I3HNF3_BCL2A1-      -WMTFLEVTGKICEMLSFLKQ-YC--------------------------
A0A2K5KHH9_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2K5KHH9_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2K5KAB6_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2K5TMD8_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
F7E8V5_BCL2A1-01        -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2K6DS80_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2K6AD55_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A096NMX5_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A0D9RRC3_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2K5D2I1_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YY--------------------------
U3DBA0_BCL2A1-01        -WMTFLEVTGKICEMLSLLKQ-YC--------------------------
A0A2K6TLM0_BCL2A1-      -WMTFLEVTGKICEMLSLLKQ-YY--------------------------
A0A286XUI2_BCL2A1-      -WLTFVGVMGQLCEMLSLLKQFY---------------------------
A0A452U2H8_BCL2A1-      -GRSERRAAATFSAGSSVRE------------------------------
A0A452U2H8_BCL2A1-      -WLTFLEVMGKICEMFSLLKQYY---------------------------
                                                                          

A0A2I3T6T8_BCL2A1-      ---
U3JTB2_BCL2A1-01        ---
H0ZCL9_BCL2A1-01        ---
Q9W6F2_BCL2A1-01        ---
G1N8C5_BCL2A1-01        ---
A0A452J3N6_BCL2A1-      ---
K7G130_BCL2A1-01        ---
F6SFL4_BCL2A1-01        ---
G3WSP8_BCL2A1-01        ---
F6S8G3_BCL2A1-01        ---
G1T1L8_BCL2A1-01        ---
O55178_BCL2A1-01        ---
Q0P538_BCL2A1-01        ---
A0A337STN9_BCL2A1-      ---
A0A337STN9_BCL2A1-      ---
E2RS00_BCL2A1-01        ---
M3YVH4_BCL2A1-01        ---
A0A452SIR9_BCL2A1-      ---
G3V977_BCL2A1-01        ---
Q925A9_BCL2A1-01        ---
Q07440_BCL2A1-01        ---
O55179_BCL2A1-01        ---
O55177_BCL2A1-02        ---
Q497M6_BCL2A1-01        ---
Q8K164_BCL2A1-01        ---
Q4FK02_BCL2A1-01        ---
I3MCZ7_BCL2A1-01        ---
G3T8E6_BCL2A1-01        ---
H0WZ23_BCL2A1-01        ---
A0A2K6TLM0_BCL2A1-      ---
A0A2K5D2I1_BCL2A1-      ---
U3DBA0_BCL2A1-02        ---
A0A2K6TLM0_BCL2A1-      ---
B4E1X9_BCL2A1-01        ---
Q16548_BCL2A1-02        ---
A0A2I2YML2_BCL2A1-      ---
A0A2R8ZJX9_BCL2A1-      ---
A0A2I3T6T8_BCL2A1-      ---
A0A2I3HNF3_BCL2A1-      ---
A0A2K6PHG5_BCL2A1-      ---
A0A2K6LV22_BCL2A1-      ---
F7E8V5_BCL2A1-02        ---
A0A2K5KHH9_BCL2A1-      ---
A0A2K6AD55_BCL2A1-      ---
A0A2K5TMD8_BCL2A1-      ---
A0A2K5KAB6_BCL2A1-      ---
A0A2K6DS80_BCL2A1-      ---
A0A096NMX5_BCL2A1-      ---
A0A2K6EKG1_BCL2A1-      ---
Q3C2I0_BCL2A1-01        ---
A0A452EK63_BCL2A1-      ---
W5Q0N6_BCL2A1-01        ---
F7CP56_BCL2A1-01        ---
C7F841_BCL2A1-02        ---
C7F841_BCL2A1-01        ---
A0A2I3HNF3_BCL2A1-      DVT
A0A2I2YML2_BCL2A1-      ---
A0A2R8ZJX9_BCL2A1-      ---
A0A2I3T6T8_BCL2A1-      ---
H2NNZ9_BCL2A1-01        ---
Q16548_BCL2A1-01        ---
A0A2I2YML2_BCL2A1-      ---
A0A2K6LV22_BCL2A1-      ---
A0A2K6PHG5_BCL2A1-      ---
A0A2R8ZJX9_BCL2A1-      ---
A0A2I3T6T8_BCL2A1-      ---
A0A2I3HNF3_BCL2A1-      ---
A0A2K5KHH9_BCL2A1-      ---
A0A2K5KHH9_BCL2A1-      ---
A0A2K5KAB6_BCL2A1-      ---
A0A2K5TMD8_BCL2A1-      ---
F7E8V5_BCL2A1-01        ---
A0A2K6DS80_BCL2A1-      ---
A0A2K6AD55_BCL2A1-      ---
A0A096NMX5_BCL2A1-      ---
A0A0D9RRC3_BCL2A1-      ---
A0A2K5D2I1_BCL2A1-      ---
U3DBA0_BCL2A1-01        ---
A0A2K6TLM0_BCL2A1-      ---
A0A286XUI2_BCL2A1-      ---
A0A452U2H8_BCL2A1-      ---
A0A452U2H8_BCL2A1-      ---
                           

© 1998-2019