Dataset for protein Bcl-2 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

99 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1MZW1_BCL2-01          --------------------------------------------------
A0A287APJ6_BCL2-01      --------------------MLLLAAAFLVAFVLLLYMVSPLISPK----
A0A3Q3B0R2_BCL2-01      --------------------------MEVNRFIVENYICHKLSKRGYAWG
A0A3Q2PN77_BCL2-01      ------------------------MANDCNRDIVENYIFHKLSKRGYAWR
A0A1X9JZA1_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKQGYEWG
A0A3Q0S5Z7_BCL2-01      ------------------------MANEYNRNIVEKYICHKLSKRGYAWG
A0A3P8QVM8_BCL2-01      ------------------------MENEYNRNIVEKYICHKLSKRGFVWG
A0A3P9DIG5_BCL2-01      ------------------------MENEYNRNIVEKYICHKLSKRGFVWG
A0A3Q2UYW8_BCL2-01      ------------------------MANEYNRNIVEKYICHKLSKRGFVWG
A0A3B4G3K4_BCL2-01      ------------------------MANEYNRNIVEKYICHKLSKRGFVWG
A0A3Q1I5N1_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYAWG
A0A3Q3K1K1_BCL2-01      ------------------------MANECNRNVVEKYICHKLSKRGYVWG
A0A3Q3MEY1_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A3Q1FLK7_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A3Q1B8C3_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A3P8S9L3_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A3B5BBQ0_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYAWG
A0A3B4TX71_BCL2-01      ------------------------MASEYNRNIVEKYICHKLSKQGYVWG
A0A3B4YAG2_BCL2-01      ------------------------MASEYNRNIVEKYICHKLSKRGYVWG
Q564A4_BCL2-01          ---------------------MANEISYDNRNIVEKYLKHKLSKRGYVWK
W5N4F7_BCL2-01          --------------------MANNEAPYDTRNIVTKYIHHKLLKKGYVWE
B9ZYL7_BCL2-01          -------------------MAHPRRGGYDHRDIVVKYIHYKLSQKGYAWE
A0A452I9V7_BCL2-01      MYLTACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIHYKLSQRGYDWA
H9GPE7_BCL2-01          -------------------MAHPGIRGYDNREIVLRYIHYKLSQKGYDWV
A0A3Q2HRY3_BCL2-02      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
K7F5Y4_BCL2-02          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
K7F5Y4_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
F6YNL8_BCL2-01          ------------------MMAHPGRRGYDNREIVMKYIHYKLSQRGYEWD
H0YUX3_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
H0W1T3_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
J9NXG3_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G1LID1_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
I3MVK9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G1TW27_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
P10417_BCL2-02          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A096MPU7_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
P10417_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q7TSN8_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q6R755_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q9JJV8_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q923R6_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
F1LNV0_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
P49950_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
H2NWH5_BCL2-01          -------------------MAHAGTTGYDNREIVDEXIHYKLSQRGYEWD
A0A3Q2HRY3_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6G3I7_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLAQRGYEWD
A0A287APJ6_BCL2-03      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
H0WKI0_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5UDI5_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5EB04_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2R8MY14_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
F7BXJ7_BCL2-01          -------------------MAHPRRGGYDHRDIVVKYIHYKLSQKGYEWE
A0A3B3TCS4_BCL2-01      ---------------------MANDVPYDSRNIVEIYIYHKLLKTGYVWE
A0A3P8YNB4_BCL2-01      ------------------------MADDDNRFIVEKYICHKLLKRGYAWD
A0A3P9AAB2_BCL2-01      ---------------------MANENPYDSRVIVENYIYDKLLKNGFVWE
A0A0U3DHY6_BCL2-01      ---------------------MANENPYDSRFIVEKYIHNKLLKKGFVWE
X4ZGI8_BCL2-01          ---------------------MANEIRYDNRNIVEKYLNHKLSKKGYEWK
U3KEW4_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
Q00709_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
K7F5Y4_BCL2-03          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
G3WZW9_BCL2-01          -------------------MAHPGRRGYDNREIVMKYIHYKLSQRGYEWD
A0A452R145_BCL2-02      -------------------------------------------------M
M3YYK3_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRG----
P10415_BCL2-04          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6R2I6_BCL2-02      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
J9NXG3_BCL2-01          ----------------------------------MKYIHYKLSQRGYEWD
A0A1D5QRF2_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2R9APW6_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G3ULB7_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWE
A9QXG9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5NZS5_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A0D9S017_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6CIX3_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5XRD4_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6KHG1_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6R2I6_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5HK49_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G3QES9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2I3GZF9_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6UEL3_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
P10415_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
P10415_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
H2QEM8_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2U4BHU7_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q75SV7_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
M3X1R9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A076FU27_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
F6R2C4_BCL2-01          -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
O02718_BCL2-01          -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
A0A076FZV9_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
A0A452EV13_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
G1LID1_BCL2-01          --------------------------------------------------
A0A452R145_BCL2-01      -------------------------------------------------M
G3WZW9_BCL2-02          ---PFGCSPWCSLLSPLGIMAHPGRRGYDNREIVMKYIHYKLSQRGYD--
G3ULB7_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWE
A0A452T603_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYD--
A0A3P8WUE9_BCL2-01      ---------------MYLVPNSAGMASECNRYIVEKYICHKLAKRGYVWE
A0A3Q3G1D7_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYEWG
A0A3B4A3G8_BCL2-01      ------------------------MANDCNRNIVEKYICHKLSKRGFAWG
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A287APJ6_BCL2-01      ----------------PLALPGAHVVVTGGSSGIGKCIAIECYKQGAFIT
A0A3Q3B0R2_BCL2-01      SDR-------------PRRVRD-------DAANNGSVASQSP--------
A0A3Q2PN77_BCL2-01      FDG-------------VR--DD-------DAAANGGLGDRSP--------
A0A1X9JZA1_BCL2-01      FDA-------------VR--NA-------DAGNNGSIVAPPP--------
A0A3Q0S5Z7_BCL2-01      FDG-------------VQ--DE-------DAANNGSINDPPP--------
A0A3P8QVM8_BCL2-01      FRV-------------VQ--EE-------DAANNGSITDPPP--------
A0A3P9DIG5_BCL2-01      FRV-------------VQ--EE-------DAANNGSITDPPP--------
A0A3Q2UYW8_BCL2-01      FRV-------------VQ--EE-------DAANNGSITDPPP--------
A0A3B4G3K4_BCL2-01      FRV-------------VQ--EE-------DAANNGSITDPPP--------
A0A3Q1I5N1_BCL2-01      FHD-------------AQ--DE-------DAANNGSAVPPPP--------
A0A3Q3K1K1_BCL2-01      FHD-------------VQ--DE-------DAANNGSIVAPPP--------
A0A3Q3MEY1_BCL2-01      FHN-------------VQ--DE-------DAANNGSVVAPPP--------
A0A3Q1FLK7_BCL2-01      FDD-------------VR--DE-------DAANNGSVVDPPP--------
A0A3Q1B8C3_BCL2-01      FDD-------------VR--DE-------DAANNGSVVDPPP--------
A0A3P8S9L3_BCL2-01      FDD-------------VR--DE-------DAANNGSVVDPPP--------
A0A3B5BBQ0_BCL2-01      FDD-------------VR--DE-------DAANNGSVVDPPP--------
A0A3B4TX71_BCL2-01      FDD-------------VR--DE-------DAANNGSIVAPPP--------
A0A3B4YAG2_BCL2-01      FDD-------------VR--DE-------DAANNGSIVAPPP--------
Q564A4_BCL2-01          CQS-------------SAEEDDTFNKAVEESSPNSDR-------------
W5N4F7_BCL2-01          SRV-------------SGETDPPNNGLVGPSASGPGL-------------
B9ZYL7_BCL2-01          EGRQQVSAEH------PQASAAISNYSDDGEMPAASADSRGPPQSSLASA
A0A452I9V7_BCL2-01      ANENRG----------PVSPNL-------SPPTVTGTSSDHAGLMS----
H9GPE7_BCL2-01          A---------------SGDRGK-------SASLSPELLNSDPVSTN----
A0A3Q2HRY3_BCL2-02      AGD-------------AGAAPL-------GATPVPGIFSSQPGRTP----
K7F5Y4_BCL2-02          ANENR-----------GPVSSS-------LSPPAAGTPSDHAGLVS----
K7F5Y4_BCL2-01          ANENR-----------GPVSSS-------LSPPAAGTPSDHAGLVS----
F6YNL8_BCL2-01          AGDLRAPASP------SLPPVV-------ASAPAVGIFSTQPRNTP----
H0YUX3_BCL2-01          AGEDRASLPPDHSASAAAAIAA-------AAIAAAGTSDHTGLVSP----
H0W1T3_BCL2-01          AGD-------------GSAL----------------------GRNS----
J9NXG3_BCL2-02          AGE-------------AGAAPP-------GAAPAPGI-------------
G1LID1_BCL2-02          AGD-------------AAPA------------------------------
I3MVK9_BCL2-01          AGD-------------VGAASP-------GAAPGPGIFSSQPGS------
G1TW27_BCL2-01          AGD-------------A------------GAASAPGVFSSQP--------
P10417_BCL2-02          AGD-------------ADAAPL-------GAAPTPGIFSFQPESNP----
A0A096MPU7_BCL2-01      AGD--------------GAATP-------GAAPAPGIFSSQPGHTP----
P10417_BCL2-01          AGD-------------ADAAPL-------GAAPTPGIFSFQPESNP----
Q7TSN8_BCL2-01          AGD-------------ADAAPL-------GAAPTPGIFSFQPESNP----
Q6R755_BCL2-01          VGD-------------VDAAPL-------GAAPTPGIFSFQPESNP----
Q9JJV8_BCL2-01          VGD-------------VDAAPL-------GAAPTPGIFSFQPESNP----
Q923R6_BCL2-01          VGD-------------VDAAPL-------GAAPTPGIFSFQPESNP----
F1LNV0_BCL2-01          TGD-------------EDSAPL-------RAAPTPGIFSFQPESNR----
P49950_BCL2-01          TGD-------------EDSAPL-------RAAPTPGIFSFQPESNR----
H2NWH5_BCL2-01          AGD-------------VGAAPP-------GAATAPGIFSSQPGHTP----
A0A3Q2HRY3_BCL2-01      AGD-------------AGAAPL-------GATPVPGIFSSQPGRTP----
A0A2K6G3I7_BCL2-01      AGD-------------AGAAPP-------GAAPTPGIFSSQPGRNP----
A0A287APJ6_BCL2-03      AGD-------------AGAASP-------GAAPAPGIFSSQPGRTP----
H0WKI0_BCL2-01          AGD-------------VGVAPP-------GAATAPGVFSSQPGRTP----
A0A2K5UDI5_BCL2-01      AGD-------------VGAATP-------GAAPAPGIFSSQPGHTP----
A0A2K5EB04_BCL2-01      AGD-------------VGAAPP-------GAAPAPGIFSSQPGHTP----
A0A2R8MY14_BCL2-01      AGD-------------VGAAPP-------GAAPAEGIFSSQPGHTP----
F7BXJ7_BCL2-01          EGR-------------QQVSA--------EHPQASAAISNYSDDGE----
A0A3B3TCS4_BCL2-01      FQA-------------AGDTDSPNNGSV-DSPPGSQVLARRSQAAA----
A0A3P8YNB4_BCL2-01      FED-------------AEEEDGANNGS--MISPPPGLVRRIHGASK----
A0A3P9AAB2_BCL2-01      FQT-------------ENQSRNNVFEDP-SPPNSPELFARRLQPPA----
A0A0U3DHY6_BCL2-01      FQA-------------ENDSPNNLFGDP-STPNTPEVFARRSQPTA----
X4ZGI8_BCL2-01          FQS-------------SGEDDDTINTGVEDSSP-----------------
U3KEW4_BCL2-01          AGE--------------------------HRAPLPPGLSAPAAAAV----
Q00709_BCL2-01          AGE--------------------------DRPPVPPAPAPAAAPAA----
K7F5Y4_BCL2-03          ANE-------------NRGPVS----------------------------
G3WZW9_BCL2-01          AGN-------------LRTPASPSLPPVVASAPAVGIFSNQPRHTP----
A0A452R145_BCL2-02      PET-------------RAPRPR-------GPPPRRASSPPSLGSPP----
M3YYK3_BCL2-01          -------------------------------RPVMKLVYLPTAPPP----
P10415_BCL2-04          AGD-------------VGAAPP-------GAAPAPGIFSSQPGHTP----
A0A2K6R2I6_BCL2-02      AGD-------------VGAATP-------GAAPAPGIFSSQPGHTP----
J9NXG3_BCL2-01          AGE-------------AGAAPP-------GAAPAPGISASQXXXXX----
A0A1D5QRF2_BCL2-01      AGD-------------VGAATP-------GAAPAPGIFSSQPGHTP----
A0A2R9APW6_BCL2-01      AGD-------------VGAAP-----------------------------
G3ULB7_BCL2-01          AGE-------------ASAAPP-------GAAPAPGVLSSPPAAPR----
A9QXG9_BCL2-01          AGD-------------VGAAPP-------GAAPAPGIFSSQPGHTP----
A0A2K5NZS5_BCL2-01      AGD-------------VGAATP-------GVAPAPGIFSSQPGHTP----
A0A0D9S017_BCL2-01      AGD-------------VGAATP-------GAAPAPGIFSSQPGHTP----
A0A2K6CIX3_BCL2-01      AGD-------------VGAATP-------GAAPAPGIFSSQPGHTP----
A0A2K5XRD4_BCL2-01      AGD-------------VGAATP-------GVAPAPGIFSSQPGHTP----
A0A2K6KHG1_BCL2-01      AGD-------------VGAATP-------GAAPAPGIFSSQPGHTP----
A0A2K6R2I6_BCL2-01      AGD-------------VGAATP-------GAAPAPGIFSSQPGHTP----
A0A2K5HK49_BCL2-01      AGD-------------VGAATP-------GAAPAPGIFSSQPGHTP----
G3QES9_BCL2-01          AGD-------------VGAVPP-------GAAPAPGIFSSQPGHTP----
A0A2I3GZF9_BCL2-01      AGD-------------VGAAPP-------GAAPAPGIFSSQPGHTP----
A0A2K6UEL3_BCL2-01      AGD-------------VGAAPP-------GAAPAPGIFSSQPGHTP----
P10415_BCL2-01          AGD-------------VGAAPP-------GAAPAPGIFSSQPGHTP----
P10415_BCL2-02          AGD-------------VGAAPP-------GAAPAPGIFSSQPGHTP----
H2QEM8_BCL2-01          AGD-------------VGAAPP-------GAAPAPGIFSSQPGHTP----
A0A2U4BHU7_BCL2-01      AGV-------------AGATSP-------GAAPAPGIFSSQPGSTP----
Q75SV7_BCL2-01          AGE-------------AGAAPP-------GAAPAPGIFSSQPGRAP----
M3X1R9_BCL2-01          AGD-------------AGAAPP-------GAAPAPGIFSSQPGRTP----
A0A076FU27_BCL2-01      ARA-------------AGAAPP-------GAAPAPGILSSQPGRTP----
F6R2C4_BCL2-01          AGD-------------AGAAPP-------GAAPAPGILSSQPGRTP----
O02718_BCL2-01          AGD-------------AGAAPP-------GAAPAPGILSSQPGRTP----
A0A076FZV9_BCL2-01      AGA-------------AGAAPP-------GAAPAPGILSSQPGRTP----
A0A452EV13_BCL2-01      AGA-------------AGAAPP-------GAAPAPGILSSQPGRAP----
G1LID1_BCL2-01          ---------------------------------------PHPAASP----
A0A452R145_BCL2-01      PET-------------RAPRPR-------GPPPRRASSPPSLGSPP----
G3WZW9_BCL2-02          ----------------------------------V---------------
G3ULB7_BCL2-02          AGE-------------ADTRTS-------PLQADP---------------
A0A452T603_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      HDE-------------DRDG---------DAANNGSIVSRPP--------
A0A3Q3G1D7_BCL2-01      FED-------------EQDE---------DAANNGSLVAPPP--------
A0A3B4A3G8_BCL2-01      FHE-------------DAEDEG-------DVANNGSIVASSP--------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A287APJ6_BCL2-01      LVARNEDKLLQAKKEIEKHSINDKQVVLCISVDVSQD-------------
A0A3Q3B0R2_BCL2-01      -------------------------------TLVRRC--------RGARG
A0A3Q2PN77_BCL2-01      -------------------------------TLVRRC--------RDAAA
A0A1X9JZA1_BCL2-01      -------------------------------SLVRRC--------RGAST
A0A3Q0S5Z7_BCL2-01      -------------------------------TLVRRC--------REPSN
A0A3P8QVM8_BCL2-01      -------------------------------TLVHRC--------REAST
A0A3P9DIG5_BCL2-01      -------------------------------TLVHRC--------REAST
A0A3Q2UYW8_BCL2-01      -------------------------------TLVHRC--------REAST
A0A3B4G3K4_BCL2-01      -------------------------------TLVHRC--------REAST
A0A3Q1I5N1_BCL2-01      -------------------------------TLVRRC--------REAST
A0A3Q3K1K1_BCL2-01      -------------------------------TLVRRC--------REAST
A0A3Q3MEY1_BCL2-01      -------------------------------TVVRRC--------RDAST
A0A3Q1FLK7_BCL2-01      -------------------------------TLVRRC--------HEAST
A0A3Q1B8C3_BCL2-01      -------------------------------TLVRRC--------HEAST
A0A3P8S9L3_BCL2-01      -------------------------------TLVRRC--------HEAST
A0A3B5BBQ0_BCL2-01      -------------------------------TLVRRC--------HEAST
A0A3B4TX71_BCL2-01      -------------------------------TLVRRC--------REANT
A0A3B4YAG2_BCL2-01      -------------------------------TLVRRC--------REANT
Q564A4_BCL2-01          ---------------------------------------------RLQAP
W5N4F7_BCL2-01          ---------------------------------------------QARRL
B9ZYL7_BCL2-01          ASSDEETPSNTPITFVGNAPAVPRRSASAVSPLAELNVEPRDLNVNPDAS
A0A452I9V7_BCL2-01      ------------------LPPEPPG------SAAASN-------------
H9GPE7_BCL2-01          ------------------APREEPD-------------------------
A0A3Q2HRY3_BCL2-02      ------------------APA-------------RTS--------PLLPP
K7F5Y4_BCL2-02          ------------------LPPEPPG------SAAASN-------------
K7F5Y4_BCL2-01          ------------------LPPEPPG------SAAASN-------------
F6YNL8_BCL2-01          ------------------LPAEPQD------SATSTTAAARNSPLPLPPP
H0YUX3_BCL2-01          ------------------HPEPPGS------ATASHT--------PPAE-
H0W1T3_BCL2-01          ------------------PLGVPRD------PAARTS--------PPPPL
J9NXG3_BCL2-02          --------------------------------------------------
G1LID1_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          -----------------------HT------PAARTS--------PPPPP
G1TW27_BCL2-01          ------------------APAAPRD------PAARTS--------PPPP-
P10417_BCL2-02          ------------------MPAVHRD------MAARTS--------PLRP-
A0A096MPU7_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
P10417_BCL2-01          ------------------MPAVHRD------MAARTS--------PLRP-
Q7TSN8_BCL2-01          ------------------MPAVHRD------MAARTS--------PLRP-
Q6R755_BCL2-01          ------------------TPAVHRD------MAARTS--------PLRP-
Q9JJV8_BCL2-01          ------------------TPAVHRD------MAARTS--------PLRP-
Q923R6_BCL2-01          ------------------TPAVHRD------MAARTS--------PLRP-
F1LNV0_BCL2-01          ------------------TPAVHRD------TAARTS--------PLRP-
P49950_BCL2-01          ------------------TPAVHRD------TAARTS--------PLRP-
H2NWH5_BCL2-01          ------------------HPAASRD------PA-RTS--------PLPTP
A0A3Q2HRY3_BCL2-01      ------------------APA-------------RTS--------PLLPP
A0A2K6G3I7_BCL2-01      ------------------PPAAPRD------PAARTS--------PPP--
A0A287APJ6_BCL2-03      ------------------APA-------------RTS--------PPPTP
H0WKI0_BCL2-01          ------------------TPAAPRD------PAARTS--------PPAAP
A0A2K5UDI5_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
A0A2K5EB04_BCL2-01      ------------------GPAAPRD------PVSRTS--------PPPPP
A0A2R8MY14_BCL2-01      ------------------GPAAPRD------PVARTS--------PPPPP
F7BXJ7_BCL2-01          ------------------MPAASAD---------SRG--------PPQSS
A0A3B3TCS4_BCL2-01      ------------------AGGEDAS------PVRSRT--------PRFDP
A0A3P8YNB4_BCL2-01      ------------------AGQGSVP------HISKWL--------SQPDP
A0A3P9AAB2_BCL2-01      ------------------AGEDNDP------QFANRI--------PQPDP
A0A0U3DHY6_BCL2-01      ------------------AVEDTDS------PFQNRS--------PQPDP
X4ZGI8_BCL2-01          ---------------------------------SSDR--------RLQAP
U3KEW4_BCL2-01          ------------------AAAAGTSSDHTGPVSPHPE--------PPGSA
Q00709_BCL2-01          ------------------VAAAGASSHH------RPE--------PPGSA
K7F5Y4_BCL2-03          ---------------------------------SSLS--------PPAAG
G3WZW9_BCL2-01          ------------------LPAAPQDLATSTTAAARNS--------PLPPP
A0A452R145_BCL2-02      ------------------RPPGPR----------RLP--------PPAAP
M3YYK3_BCL2-01          ------------------PPLSRHR------RPQLTS--------PATAL
P10415_BCL2-04          ------------------HPAASRD------PVARTS--------PLQTP
A0A2K6R2I6_BCL2-02      ------------------HPAASRD------PVARTS--------PLPTP
J9NXG3_BCL2-01          ------------------XXXXXXX------XXXXXX--------XXXX-
A0A1D5QRF2_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3ULB7_BCL2-01          ------------------GPD------------TRTS--------PLQAD
A9QXG9_BCL2-01          ------------------HPAASRD------PVARTS--------PLQTP
A0A2K5NZS5_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
A0A0D9S017_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
A0A2K6CIX3_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
A0A2K5XRD4_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
A0A2K6KHG1_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
A0A2K6R2I6_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
A0A2K5HK49_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
G3QES9_BCL2-01          ------------------HPAASRD------RVARTS--------PLQTP
A0A2I3GZF9_BCL2-01      ------------------HPAASRD------PVARTS--------PLPTP
A0A2K6UEL3_BCL2-01      ------------------GPAAPRD------PVARTX--------XXXXX
P10415_BCL2-01          ------------------HPAASRD------PVARTS--------PLQTP
P10415_BCL2-02          ------------------HPAASRD------PVARTS--------PLQTP
H2QEM8_BCL2-01          ------------------HPAASRD------PVARTS--------PLQTP
A0A2U4BHU7_BCL2-01      ------------------AP-------------SRTS--------PPPPQ
Q75SV7_BCL2-01          ------------------AP-------------ARTS--------PPPPP
M3X1R9_BCL2-01          ------------------AP-------------ARTS--------PPPPP
A0A076FU27_BCL2-01      ------------------AP-------------SRTS--------PPPPP
F6R2C4_BCL2-01          ------------------AP-------------SRTS--------PPPPP
O02718_BCL2-01          ------------------AP-------------SRTS--------PPPPP
A0A076FZV9_BCL2-01      ------------------AP-------------SRTS--------PPPPP
A0A452EV13_BCL2-01      ------------------AP-------------SRTS--------PPPPP
G1LID1_BCL2-01          ------------------RPFVRRW------QVAP----------PSAAA
A0A452R145_BCL2-01      ------------------RPPGPRR------LPPPAA--------PAAAA
G3WZW9_BCL2-02          --------------------------------------------------
G3ULB7_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      -------------------------------TLV-HR--------CRGAS
A0A3Q3G1D7_BCL2-01      -------------------------------TLV-RR--------CREAS
A0A3B4A3G8_BCL2-01      -------------------------------VLVNRR--------CRAE-
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A287APJ6_BCL2-01      -------------YSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLE
A0A3Q3B0R2_BCL2-01      -APGGAGTAPPDAESDPDPVLCG-RISPHEPLAHIHRVLREAGDELERLY
A0A3Q2PN77_BCL2-01      PGQ----------DSDGDPRRVRGRLSQSDPHADIHRVLREAGDELERLY
A0A1X9JZA1_BCL2-01      -GP----------DSESIPHLCT-RLPQSDPHAAIHRVLREAGDELERLY
A0A3Q0S5Z7_BCL2-01      -GP----------DGESNTHLCR-RLPQSDPHADIHRVLREAGDELERLY
A0A3P8QVM8_BCL2-01      -GP----------DGESNTHLCR-RLPQSDPHAGIHRVLREAGDELERLY
A0A3P9DIG5_BCL2-01      -GP----------DGESNTHLCR-RLPQSDPHAGIHRVLREAGDELERLY
A0A3Q2UYW8_BCL2-01      -GP----------DGESNTHLCR-RLPQSDPHAGIHRVLREAGDELERLY
A0A3B4G3K4_BCL2-01      -GP----------DGESNTHLCR-RLPQSDPHAGIHRVLREAGDELERLY
A0A3Q1I5N1_BCL2-01      -GP----------DSDSIPQHCR-RLPPSDPHAALHRVLREAGDELERLY
A0A3Q3K1K1_BCL2-01      -GP----------DSESTPHRCK-RPPQSDMHAAIHRVLREAGDELERLY
A0A3Q3MEY1_BCL2-01      -GP----------DSESIPQLCR-GLPQSDPQAAIHRVLREAGDELERLY
A0A3Q1FLK7_BCL2-01      -GP----------DNESDPHLCR-RLPQSDPHAAIHRVLREAGDELERLY
A0A3Q1B8C3_BCL2-01      -GP----------DNESDPHLCR-RLPQSDPHAAIHRVLREAGDELERLY
A0A3P8S9L3_BCL2-01      -GP----------DNESDPHLCR-RLPQSDPHAAIHRVLREAGDELERLY
A0A3B5BBQ0_BCL2-01      -GP----------DNESDPHLCR-RLPQSDPHAAIHRVLREAGDELERLY
A0A3B4TX71_BCL2-01      -GP----------DNDSSPNLCR-RLSQSDPHAEIHRVLREAGDELERLY
A0A3B4YAG2_BCL2-01      -GP----------DNDSSPNLCR-RLSQSDPHAEIHRVLREAGDELERLY
Q564A4_BCL2-01          SAG----------GGNNSECLIARVT-RSDPHLRLYRVLRDAGDEIERIY
W5N4F7_BCL2-01          QAA----------GAERGAVPVPRRTPPPDPHAALHKVLREAGDEIERMY
B9ZYL7_BCL2-01          RAA----------DGDNNDADGGDEAVMQPVPSAVLQTLSRAGDEFSRLY
A0A452I9V7_BCL2-01      --------------------V-PLGDGLRPAPQAVLLALCQAGDEFSRRY
H9GPE7_BCL2-01          -----------------------------PVPQVVHTTLRQAGDEFSRRY
A0A3Q2HRY3_BCL2-02      AAP----------------AG-AAGPALSPVPPVVHLTLRQAGDDFSRRY
K7F5Y4_BCL2-02          --------------------V-PLGDGLRSAPQAVHLTLCQAGDEFSRRY
K7F5Y4_BCL2-01          --------------------V-PLGDGLRSAPQAVHLTLCQAGDEFSRRY
F6YNL8_BCL2-01          AVA---------------AAA-AAGPTVSPVPPVVHLTLRQAGDDFSRRY
H0YUX3_BCL2-01          --------------------------GLRPAPQAVHLVLRQAGDEFSRRY
H0W1T3_BCL2-01          AG----------------LAV-AQGPALSPVPPVVHLTLRQAGDDFSRRY
J9NXG3_BCL2-02          ------------------------SASXSPVPPVVHLTLRQAGDDFSRRY
G1LID1_BCL2-02          ------------------AAA-AAGPALSPVPPVVHLTLRQAGDDFSRRY
I3MVK9_BCL2-01          AAP----------------AA-AAGPVLSPVPPVVHLTLRQAGDDFSRRY
G1TW27_BCL2-01          -------------------PA-AAGPALSPVPPVVHLTLRQAGDDFSRRY
P10417_BCL2-02          ------------------LVA-TAGPALSPVPPVVHLTLRRAGDDFSRRY
A0A096MPU7_BCL2-01      AAP----------------AA-AAGPALSPVPPVVHLTLRQAGDDFSRRY
P10417_BCL2-01          ------------------LVA-TAGPALSPVPPVVHLTLRRAGDDFSRRY
Q7TSN8_BCL2-01          ------------------LVA-TAGPALSPVPPVVHLTLRRAGDDFSRRY
Q6R755_BCL2-01          ------------------IVA-TTGPTLSPVPPVVHLTLRRAGDDFSRRY
Q9JJV8_BCL2-01          ------------------IVA-TTGPTLSPVPPVVHLTLRRAGDDFSRRY
Q923R6_BCL2-01          ------------------IVA-TTGPTLSPVPPVVHLTLRRAGDDFSRRY
F1LNV0_BCL2-01          ------------------LVA-TAGPALSPVPPVVHLTLRRAGDDFSRRY
P49950_BCL2-01          ------------------LVA-NAGPALSPVPPVVHLTLRRAGDDFSRRY
H2NWH5_BCL2-01          AAP----------------GA-AVGPALSPVPPVVHLTLRQAGDDFSRRY
A0A3Q2HRY3_BCL2-01      AAP----------------AG-AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2K6G3I7_BCL2-01      -------------------AA-AAGPAPSPVPPVVHLTLRQAGDDFSRRY
A0A287APJ6_BCL2-03      TAP----------AATAAAAA-AAGPVLSPVPPVVHLTLRQAGDDFSRRY
H0WKI0_BCL2-01          A-----------------AAA-AAEPLLSPVPPVVHLTLRQAGDDFSRRY
A0A2K5UDI5_BCL2-01      AAP-------------AAAAA-AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2K5EB04_BCL2-01      AAP---------------AAA-ATGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2R8MY14_BCL2-01      AAP---------------AAA-ATGPTLSPVPPVVHLTLRQAGDDFSRRY
F7BXJ7_BCL2-01          LAS----------AA-------ASSAAMQPVPPAVLQTLSRAGDEFSRLY
A0A3B3TCS4_BCL2-01      HAR-------------------------------LHRVLREAGDEIERMF
A0A3P8YNB4_BCL2-01      HA-------------------------------AIHRVLREAGDELERLY
A0A3P9AAB2_BCL2-01      HAR-------------------------------LHRVLRDAGNEIERMY
A0A0U3DHY6_BCL2-01      HVR-------------------------------LHRVLREAGDEIERMY
X4ZGI8_BCL2-01          SAG----------GGNNSECLIANRVTRSDPYSRIYRSLREAGDQIERMY
U3KEW4_BCL2-01          AAS----------PA-------PPAEGLRPAPQVVHLVLRQAGDEFSRRY
Q00709_BCL2-01          AAS----------EV-------PPAEGLRPAPPGVHLALRQAGDEFSRRY
K7F5Y4_BCL2-03          SAA----------ASNV-----PLGDGLRSAPQAVHLTLCQAGDEFSRRY
G3WZW9_BCL2-01          PAV----------AAATV----AAGPAVSPVPPVVHLTLRQAGDDFSRRY
A0A452R145_BCL2-02      AAA----------AA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
M3YYK3_BCL2-01          AAA----------A--------AAGPALSPVPPVVHLTLRQAGDDFSRRY
P10415_BCL2-04          AAP----------GA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2K6R2I6_BCL2-02      AAP----------AA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
J9NXG3_BCL2-01          ----------------------XXXXXXSPVPPVVHLTLRQAGDDFSRRY
A0A1D5QRF2_BCL2-01      AAP----------AAAA-----AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2R9APW6_BCL2-01      ---------------------------LSPVPPVVHLTLRQAGDDFSRRY
G3ULB7_BCL2-01          P---------------------AAQPALSPVPPVVHLTLRQAGDDFSRRY
A9QXG9_BCL2-01          AAP----------GA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2K5NZS5_BCL2-01      AAP----------AA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A0D9S017_BCL2-01      AAP----------AA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2K6CIX3_BCL2-01      AAP----------AA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2K5XRD4_BCL2-01      AAP----------AA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2K6KHG1_BCL2-01      AAP----------AA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2K6R2I6_BCL2-01      AAP----------AA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2K5HK49_BCL2-01      AAP----------AA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
G3QES9_BCL2-01          AAP----------GA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2I3GZF9_BCL2-01      AAP----------GA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2K6UEL3_BCL2-01      XXX----------XX-------XXXXXXSPVPPVVHLTLRQAGDDFSRRY
P10415_BCL2-01          AAP----------GA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
P10415_BCL2-02          AAP----------GA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
H2QEM8_BCL2-01          AAP----------GA-------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A2U4BHU7_BCL2-01      TAP----------AAP------AGGPALSPVPPVVHLTLRQAGDDFSRRY
Q75SV7_BCL2-01          AAP----------AAAAAAAADAAGPAPSPVPPVVHLTLRQAGDDFSRRY
M3X1R9_BCL2-01          VAP----------AAAAAAA--AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A076FU27_BCL2-01      AA--------------------AAGPAPSPVPPVVHLTLRQAGDDFSRRY
F6R2C4_BCL2-01          AA--------------------AAGPAPSPVPPVVHLTLRQAGDDFSRRY
O02718_BCL2-01          AA--------------------AAGPAPSPVPPVVHLTLRQAGDDFSRRY
A0A076FZV9_BCL2-01      AA--------------------AAGPAPSPVPPVVHLTLRQAGDDFSRRY
A0A452EV13_BCL2-01      AA--------------------AAGPAPSPVPPVVHLTLRQAGDDFSRRY
G1LID1_BCL2-01          A---------------------AAGPALSPVPPVVHLTLRQAGDDFSRRY
A0A452R145_BCL2-01      A---------------------AAGPALSPVPPVVHLTLRQAGDDFSRRY
G3WZW9_BCL2-02          ----------------------AAGPAVSPVPPVVHLTLRQAGDDFSRRY
G3ULB7_BCL2-02          ----------------------AAQPALSPVPPVVHLTLRQAGDDFSRRY
A0A452T603_BCL2-01      -----------------------------PVPPVVHLTLRQAGDDFSRRY
A0A3P8WUE9_BCL2-01      TGP----------GNDGIPNLCKRPPAPEA-HAAIHRVLREAGDELERLY
A0A3Q3G1D7_BCL2-01      SGP----------DRESIPHLCKRPPQSDPAYADIHRVLREAGDELERLY
A0A3B4A3G8_BCL2-01      -------------------RLCSAPSDP---HAAIHRVLREAGDELERLY
                                                                          

G1MZW1_BCL2-01          -------------------------VEELFRDGVNWGRIV---------A
A0A287APJ6_BCL2-01      VSTFERLMSVNYLGSVYPSRAVITTMKER-----RVGRIVFVSSQAGQLG
A0A3Q3B0R2_BCL2-01      QPDFVEMSRQLGLASAAAKARFAEVMDELFRDGVNWGRII---------A
A0A3Q2PN77_BCL2-01      QLDFAEMSQQLYITRDTARTRFAEVVDELFRDGVNWGRII---------A
A0A1X9JZA1_BCL2-01      QPDFTEMSRQLYLTSTTAQRRFADVIDELFRDGVNWGRII---------A
A0A3Q0S5Z7_BCL2-01      QPDFTEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRII---------A
A0A3P8QVM8_BCL2-01      QPDFTEMSRQLHLTSSTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3P9DIG5_BCL2-01      QPDFTEMSRQLHLTSSTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3Q2UYW8_BCL2-01      QPDFTEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRII---------A
A0A3B4G3K4_BCL2-01      QPDFTEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRII---------A
A0A3Q1I5N1_BCL2-01      QPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3Q3K1K1_BCL2-01      QPDFTEMSRQLHLTSTTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3Q3MEY1_BCL2-01      QPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3Q1FLK7_BCL2-01      QPDFTEMSRQLYLTTTTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3Q1B8C3_BCL2-01      QPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3P8S9L3_BCL2-01      QPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3B5BBQ0_BCL2-01      QPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3B4TX71_BCL2-01      QPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3B4YAG2_BCL2-01      QPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRII---------A
Q564A4_BCL2-01          QREFEEMSQQMVFNPNSAQRSFLTVAEELFRDGVNWGRII---------A
W5N4F7_BCL2-01          HRDFAEMSDQLHFTPNTARRKFTAVVEELFRDGVNWGRIV---------A
B9ZYL7_BCL2-01          QQDFRQISGLLHLTPSTVRVRFATVVEELFHDGVNWGRIV---------A
A0A452I9V7_BCL2-01      HRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIV---------A
H9GPE7_BCL2-01          RRDFAQMSGQLHLTPSTARSRFVAVVEELFQDGVNWGRIV---------A
A0A3Q2HRY3_BCL2-02      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
K7F5Y4_BCL2-02          HRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIV---------A
K7F5Y4_BCL2-01          HRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIV---------A
F6YNL8_BCL2-01          RRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNWGRIV---------A
H0YUX3_BCL2-01          QRDFSQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIV---------A
H0W1T3_BCL2-01          RQDFAEMSSQLHLTPFTARGRFAT----LFRDGVNWGRIV---------A
J9NXG3_BCL2-02          RR-FAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
G1LID1_BCL2-02          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
I3MVK9_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
G1TW27_BCL2-01          RRDFAEMSSQLHLTPFHARGRFATVVEELFRDGVNWGRIV---------A
P10417_BCL2-02          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A096MPU7_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
P10417_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
Q7TSN8_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
Q6R755_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
Q9JJV8_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
Q923R6_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
F1LNV0_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
P49950_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
H2NWH5_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A3Q2HRY3_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K6G3I7_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A287APJ6_BCL2-03      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
H0WKI0_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K5UDI5_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K5EB04_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2R8MY14_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
F7BXJ7_BCL2-01          QQDFRQISGLLHLTPSTVRVRFATVVEELFHDGVNWGRIV---------A
A0A3B3TCS4_BCL2-01      QRDFSEMHEELHITPSTAQRRFTAVIEELFSDGVNWGRIV---------A
A0A3P8YNB4_BCL2-01      QPDFLEMSHQLYLTSSVAERRFREVIDELFRDGVNWGRII---------A
A0A3P9AAB2_BCL2-01      QRDFAEMSGQLHITPSTAHGRFTAVIDELFSDGVNWGRIV---------A
A0A0U3DHY6_BCL2-01      LRDFAEMSGQLHFTPSTAQXRFTAVIDELFSDGVNWGRIV---------A
X4ZGI8_BCL2-01          QREFEEMSHQMTFSPSAAQRSFLAVAEELFRDGVNWGRIV---------A
U3KEW4_BCL2-01          QRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIV---------A
Q00709_BCL2-01          QRDFAQMSGQLHLTPFTAHGRFVAVVEELFRDGVNWGRIV---------A
K7F5Y4_BCL2-03          HRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIV---------A
G3WZW9_BCL2-01          RRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNWGRIV---------A
A0A452R145_BCL2-02      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
M3YYK3_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
P10415_BCL2-04          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K6R2I6_BCL2-02      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
J9NXG3_BCL2-01          RR-FAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A1D5QRF2_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2R9APW6_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
G3ULB7_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A9QXG9_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K5NZS5_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A0D9S017_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K6CIX3_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K5XRD4_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K6KHG1_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K6R2I6_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K5HK49_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
G3QES9_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2I3GZF9_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2K6UEL3_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
P10415_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
P10415_BCL2-02          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
H2QEM8_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A2U4BHU7_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
Q75SV7_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
M3X1R9_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A076FU27_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
F6R2C4_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
O02718_BCL2-01          RRDFAEMSSQLHLTPFTARERFATVVEELFRDGVNWGRIV---------A
A0A076FZV9_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A452EV13_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
G1LID1_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A452R145_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
G3WZW9_BCL2-02          RRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNWGRIV---------A
G3ULB7_BCL2-02          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A452T603_BCL2-01      RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV---------A
A0A3P8WUE9_BCL2-01      QPDFSEMSRQLYLTSSTAQRRFTEVIDELFRDGVNWGRII---------A
A0A3Q3G1D7_BCL2-01      QPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRII---------A
A0A3B4A3G8_BCL2-01      QPDFTEMSRQLYLTSSTAQRRFAEVIDELFRDGVNWGRII---------A
                                                          . ***:         .

G1MZW1_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIATW----------------------
A0A287APJ6_BCL2-01      LFGFTAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENK
A0A3Q3B0R2_BCL2-01      FFEFGGTVCVECASREEMTPQVDHIAEW----------------------
A0A3Q2PN77_BCL2-01      FFEFGGTVCVECASKEGMSSQVDNIAEW----------------------
A0A1X9JZA1_BCL2-01      FFEFGGTVCVECVAKEEMAAQVNNIAEW----------------------
A0A3Q0S5Z7_BCL2-01      FFEFGGTVCVECASNEGMTSQVDNIAEW----------------------
A0A3P8QVM8_BCL2-01      FFEFGGTVCVECASNEGMSSQVDNIADW----------------------
A0A3P9DIG5_BCL2-01      FFEFGGTVCVECASNEGMSSQVDNIADW----------------------
A0A3Q2UYW8_BCL2-01      FFEFGGTVCVECASNEGMSSQVDNIADW----------------------
A0A3B4G3K4_BCL2-01      FFEFGGTVCVECASNEGMSSQVDNIADW----------------------
A0A3Q1I5N1_BCL2-01      FFEFGGTVCVECASKEEMTPQVNNIAEW----------------------
A0A3Q3K1K1_BCL2-01      FFEFGGTMCVECAAKEEMTPQVDKIAEW----------------------
A0A3Q3MEY1_BCL2-01      FFEFGGTVCVECAAKEEMTSQVDNIAEW----------------------
A0A3Q1FLK7_BCL2-01      FFEFGGTVCVECAAKEEMTSQVDNIAEW----------------------
A0A3Q1B8C3_BCL2-01      FFEFGGTVCVECAAKEEMTSQVDNIAEW----------------------
A0A3P8S9L3_BCL2-01      FFEFGGTVCVECAAKEEMTSQVDNIAEW----------------------
A0A3B5BBQ0_BCL2-01      FFEFGGTVCVECAAKEEMTSQVDNIAEW----------------------
A0A3B4TX71_BCL2-01      FFEFGGTVCVECAAKEEMTSQVDNIVEW----------------------
A0A3B4YAG2_BCL2-01      FFEFGGTVCVECAAKEEMTSQVDNIVEW----------------------
Q564A4_BCL2-01          FFEFGGTMCVESVNRE-MASQVDNIAHW----------------------
W5N4F7_BCL2-01          FFEFGGTMCVESVNRE-MTSQVDNIANW----------------------
B9ZYL7_BCL2-01          FFEFGGVMCVEIVNRE-MSPLVDSIVGW----------------------
A0A452I9V7_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDSIAVW----------------------
H9GPE7_BCL2-01          FFEFGGMLCVESVSRE-MSPLVDNIATW----------------------
A0A3Q2HRY3_BCL2-02      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
K7F5Y4_BCL2-02          FFEFGGVMCVESVNRE-MSPLVDSIAVW----------------------
K7F5Y4_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDSIAVW----------------------
F6YNL8_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDSIALW----------------------
H0YUX3_BCL2-01          FFEFGGVMCVESVNRE-MFPLVDNIATW----------------------
H0W1T3_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
J9NXG3_BCL2-02          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
G1LID1_BCL2-02          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
I3MVK9_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
G1TW27_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
P10417_BCL2-02          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A096MPU7_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
P10417_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
Q7TSN8_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
Q6R755_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
Q9JJV8_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
Q923R6_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
F1LNV0_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
P49950_BCL2-01          FFEFGGVMCVGSVNRE-MSPLVDNIALW----------------------
H2NWH5_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A3Q2HRY3_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K6G3I7_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A287APJ6_BCL2-03      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
H0WKI0_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K5UDI5_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K5EB04_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2R8MY14_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
F7BXJ7_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDSIVGW----------------------
A0A3B3TCS4_BCL2-01      FLEFGGTMCVESVNRE-MTSQVDNIAHW----------------------
A0A3P8YNB4_BCL2-01      FFEFGGTICVECVNKE-MTSQVDHIAGW----------------------
A0A3P9AAB2_BCL2-01      FLEFGGTMCVESVNRE-MTPQVNNIVHW----------------------
A0A0U3DHY6_BCL2-01      FFEFGGTMCVESVNRE-MTSQVDNIALW----------------------
X4ZGI8_BCL2-01          FFEFGGTMCVESFNRE-MASQVDNIAHW----------------------
U3KEW4_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDSIAAW----------------------
Q00709_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIATW----------------------
K7F5Y4_BCL2-03          FFEFGGVMCVESVNRE-MSPLVDSIAVW----------------------
G3WZW9_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDSIALW----------------------
A0A452R145_BCL2-02      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
M3YYK3_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
P10415_BCL2-04          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K6R2I6_BCL2-02      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
J9NXG3_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A1D5QRF2_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2R9APW6_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
G3ULB7_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A9QXG9_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K5NZS5_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A0D9S017_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K6CIX3_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K5XRD4_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K6KHG1_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K6R2I6_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K5HK49_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
G3QES9_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2I3GZF9_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2K6UEL3_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
P10415_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
P10415_BCL2-02          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
H2QEM8_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A2U4BHU7_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
Q75SV7_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
M3X1R9_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A076FU27_BCL2-01      FFEFGGVICVESVNRE-MSPLVDSIALW----------------------
F6R2C4_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDSIALW----------------------
O02718_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDSIALW----------------------
A0A076FZV9_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDSIALW----------------------
A0A452EV13_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDSIALW----------------------
G1LID1_BCL2-01          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A452R145_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
G3WZW9_BCL2-02          FFEFGGVMCVESVNRE-MSPLVDSIALW----------------------
G3ULB7_BCL2-02          FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A452T603_BCL2-01      FFEFGGVMCVESVNRE-MSPLVDNIALW----------------------
A0A3P8WUE9_BCL2-01      FFEFGGVVCVECAAKEDLTPQVEQVVDW----------------------
A0A3Q3G1D7_BCL2-01      FFEFGGTVCVECMSKQEMTSQVDNIAEW----------------------
A0A3B4A3G8_BCL2-01      FFEFGGTVCVECASKEDMSSQVDNIADW----------------------
                        :: * .  .     .    .    :  :                      

G1MZW1_BCL2-01          -------------------------MTEYLNRHLHNWIQDNG--------
A0A287APJ6_BCL2-01      TKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSIGSDGYMLSSLTC
A0A3Q3B0R2_BCL2-01      -------------------------MTEYLNGPLNSWIEDNG--------
A0A3Q2PN77_BCL2-01      -------------------------MTEYLNGPLGSWIQDNG--------
A0A1X9JZA1_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3Q0S5Z7_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3P8QVM8_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3P9DIG5_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3Q2UYW8_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3B4G3K4_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3Q1I5N1_BCL2-01      -------------------------MTEYLNGPLHSWIQDNG--------
A0A3Q3K1K1_BCL2-01      -------------------------MTEYLNGPLNSWIQENG--------
A0A3Q3MEY1_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3Q1FLK7_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3Q1B8C3_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3P8S9L3_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3B5BBQ0_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3B4TX71_BCL2-01      -------------------------MTEYLNGPLNSWIKDNG--------
A0A3B4YAG2_BCL2-01      -------------------------MTEYLNGPLNSWIKDNG--------
Q564A4_BCL2-01          -------------------------MTDYLNGPLENWIEENG--------
W5N4F7_BCL2-01          -------------------------MTEYLNGPLQNWIQENG--------
B9ZYL7_BCL2-01          -------------------------MTEYLNRHLQNWIQEQ---------
A0A452I9V7_BCL2-01      -------------------------MTEYLNRHLHNWIQDNG--------
H9GPE7_BCL2-01          -------------------------MTEYLNQYLRNWIQENG--------
A0A3Q2HRY3_BCL2-02      -------------------------MTEYLNRHLHTWIQDNG--------
K7F5Y4_BCL2-02          -------------------------MTEYLNRHLHNWIQDNG--------
K7F5Y4_BCL2-01          -------------------------MTEYLNRHLHNWIQDNG--------
F6YNL8_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
H0YUX3_BCL2-01          -------------------------MTEYLNRHLHNWIQDNG--------
H0W1T3_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
J9NXG3_BCL2-02          -------------------------MTEYLNRHLHTWIQDNG--------
G1LID1_BCL2-02          -------------------------MTEYLNRHLHTWIQDNG--------
I3MVK9_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
G1TW27_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
P10417_BCL2-02          -------------------------MTEYLNRHLHTWIQDNG--------
A0A096MPU7_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
P10417_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
Q7TSN8_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
Q6R755_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
Q9JJV8_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
Q923R6_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
F1LNV0_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
P49950_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
H2NWH5_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
A0A3Q2HRY3_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K6G3I7_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A287APJ6_BCL2-03      -------------------------MTEYLNRHLHTWIQDNG--------
H0WKI0_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K5UDI5_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K5EB04_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A2R8MY14_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
F7BXJ7_BCL2-01          -------------------------MTEYLNSHLQNWIQEQG--------
A0A3B3TCS4_BCL2-01      -------------------------MTEYLNGPLHNWIQENG--------
A0A3P8YNB4_BCL2-01      -------------------------MTEYLNGPLHSWIQENG--------
A0A3P9AAB2_BCL2-01      -------------------------MTEYLNGPLQNWIQENG--------
A0A0U3DHY6_BCL2-01      -------------------------MTEYLNGPLQNWIQENG--------
X4ZGI8_BCL2-01          -------------------------MTDYLNGPLENWIEENG--------
U3KEW4_BCL2-01          -------------------------MTEYLNRHLHNWIQDNG--------
Q00709_BCL2-01          -------------------------MTEYLNRHLHNWIQDNG--------
K7F5Y4_BCL2-03          -------------------------MTEYLNRHLHNWIQDNG--------
G3WZW9_BCL2-01          -------------------------MTEYLNRHLHNWIQDNG--------
A0A452R145_BCL2-02      -------------------------MTEYLNRHLHTWIQDNG--------
M3YYK3_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
P10415_BCL2-04          -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K6R2I6_BCL2-02      -------------------------MTEYLNRHLHTWIQDNG--------
J9NXG3_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
A0A1D5QRF2_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A2R9APW6_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
G3ULB7_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
A9QXG9_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K5NZS5_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A0D9S017_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K6CIX3_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K5XRD4_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K6KHG1_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K6R2I6_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K5HK49_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
G3QES9_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
A0A2I3GZF9_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A2K6UEL3_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
P10415_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
P10415_BCL2-02          -------------------------MTEYLNRHLHTWIQDNG--------
H2QEM8_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
A0A2U4BHU7_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
Q75SV7_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
M3X1R9_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
A0A076FU27_BCL2-01      -------------------------MTEYLNRHLHAWIQDNG--------
F6R2C4_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
O02718_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
A0A076FZV9_BCL2-01      -------------------------MTEYLNRHLHAWIQDNG--------
A0A452EV13_BCL2-01      -------------------------MTEYLNRHLHAWIQDNG--------
G1LID1_BCL2-01          -------------------------MTEYLNRHLHTWIQDNG--------
A0A452R145_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
G3WZW9_BCL2-02          -------------------------MTEYLNRHLHNWIQDNG--------
G3ULB7_BCL2-02          -------------------------MTEYLNRHLHTWIQDNG--------
A0A452T603_BCL2-01      -------------------------MTEYLNRHLHTWIQDNG--------
A0A3P8WUE9_BCL2-01      -------------------------MTEYLNGPLNIWIKENG--------
A0A3Q3G1D7_BCL2-01      -------------------------MTEYLNGPLNSWIQDNG--------
A0A3B4A3G8_BCL2-01      -------------------------MTEYLNGTLSSWIQDNG--------
                                                 :.: ::  :   * .:         

G1MZW1_BCL2-01          ------------GWDAFVELYGT-----------SMRPLFDF------S-
A0A287APJ6_BCL2-01      GMAPVTSITEGLQQDAFVELYGP-----------SMRPLFDF------S-
A0A3Q3B0R2_BCL2-01      ------------GWDAFVELYDR-----------HKESVFSC------Y-
A0A3Q2PN77_BCL2-01      ------------GWDAFVELYDR-----------QKESIFSC------Y-
A0A1X9JZA1_BCL2-01      ------------GWDAFVELYDR-----------QRDSVFSC------S-
A0A3Q0S5Z7_BCL2-01      ------------GWDAFVELYGR-----------QRESVFSC------S-
A0A3P8QVM8_BCL2-01      ------------GWDAFVELYDR-----------QRDSVFSC------S-
A0A3P9DIG5_BCL2-01      ------------GWDAFVELYDR-----------QRDSVFSC------S-
A0A3Q2UYW8_BCL2-01      ------------GWDAFVELYDR-----------QRDSVFSC------S-
A0A3B4G3K4_BCL2-01      ------------GWDAFVELYDR-----------QRDSVFSC------S-
A0A3Q1I5N1_BCL2-01      ------------GWDAFVDLYDR-----------QRESVFSC------S-
A0A3Q3K1K1_BCL2-01      ------------GWDAFVELYDR-----------QRESVFSC------S-
A0A3Q3MEY1_BCL2-01      ------------GWDAFVEMYDR-----------QRESVFSC------S-
A0A3Q1FLK7_BCL2-01      ------------GWDAFVELYDR-----------QRDSVFSC------S-
A0A3Q1B8C3_BCL2-01      ------------GWDAFVELYDR-----------QRDSVFSC------S-
A0A3P8S9L3_BCL2-01      ------------GWDAFVELYDR-----------QRDSVFSC------S-
A0A3B5BBQ0_BCL2-01      ------------GWDAFVELYDR-----------QRDSVFSC------S-
A0A3B4TX71_BCL2-01      ------------GWDAFVELYDR-----------QRESVFSC------S-
A0A3B4YAG2_BCL2-01      ------------GWDAFVELYDR-----------QRESVFSC------S-
Q564A4_BCL2-01          ------------GWDAFVEMYGQ-----------QRDSVFH-------P-
W5N4F7_BCL2-01          ------------GWDAFVELYGR-----------QRGSMFSC------S-
B9ZYL7_BCL2-01          --------------DAFVELYNS-----------NIQPPFDQ------S-
A0A452I9V7_BCL2-01      ------------GW------------------------------------
H9GPE7_BCL2-01          ------------GW------------------------------------
A0A3Q2HRY3_BCL2-02      ------------GWQLCQAPTGSQEMFSGGWTIHSGSPLQNLCVSRAGN-
K7F5Y4_BCL2-02          ------------GWAGAVSVL-----------------------------
K7F5Y4_BCL2-01          ------------GWDAFVELYGS-----------NMRPLFDF------S-
F6YNL8_BCL2-01          ------------GWDAFVELYGN-----------SMRPLFDF------S-
H0YUX3_BCL2-01          ------------GWDAFVELYGN-----------NMRPLFDF------S-
H0W1T3_BCL2-01          ------------GW------------------------------------
J9NXG3_BCL2-02          ------------GW------------------------------------
G1LID1_BCL2-02          ------------GW--------V-----------GARPLE----------
I3MVK9_BCL2-01          ------------GW------------------------------------
G1TW27_BCL2-01          ------------GWDAFVELYGP-----------SVRPLSDF------S-
P10417_BCL2-02          ------------GW------------------------------------
A0A096MPU7_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
P10417_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
Q7TSN8_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
Q6R755_BCL2-01          ------------GWDAFVELYGP-----------TMQPLFDF------S-
Q9JJV8_BCL2-01          ------------GWDAFVELYGP-----------SVRPLFDF------S-
Q923R6_BCL2-01          ------------GWDAFVELYGP-----------SVRPLFDF------S-
F1LNV0_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
P49950_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
H2NWH5_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A3Q2HRY3_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2K6G3I7_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A287APJ6_BCL2-03      ------------GWDAFVELYGP-----------SMRPLFDF------S-
H0WKI0_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2K5UDI5_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2K5EB04_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2R8MY14_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
F7BXJ7_BCL2-01          ------------GW------------------------------------
A0A3B3TCS4_BCL2-01      ------------GWDAFVEIYGQ-----------QRGSVMAC------F-
A0A3P8YNB4_BCL2-01      ------------GWEAFVELYDR-----------QRDSVFCS--------
A0A3P9AAB2_BCL2-01      ------------GWDAFVEIYGQ-----------KRGSLFHS--------
A0A0U3DHY6_BCL2-01      ------------GWDAFVEIYEQ-----------QRISHS----------
X4ZGI8_BCL2-01          ------------GWDAFVELYSQ-----------QRDPMFHP--------
U3KEW4_BCL2-01          ------------GWDAFVELYGN-----------SMRPLFDF------S-
Q00709_BCL2-01          ------------GWDAFVELYGN-----------SMRPLFDF------S-
K7F5Y4_BCL2-03          ------------GW------------------------------------
G3WZW9_BCL2-01          ------------GW------------------------------------
A0A452R145_BCL2-02      ------------GWAH----------------------------------
M3YYK3_BCL2-01          ------------GWPAPAPHEGP-----------AARPIVDD------SY
P10415_BCL2-04          ------------GWVGA---------------------------------
A0A2K6R2I6_BCL2-02      ------------GWRTM---------------------------------
J9NXG3_BCL2-01          ------------GWDAFVELYGP-----------TMQPLFDF------S-
A0A1D5QRF2_BCL2-01      ------------GWVG--ALGDV-----------SLGWGHRF------E-
A0A2R9APW6_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
G3ULB7_BCL2-01          ------------GWDAFVELYGP-----------NMRPLFDF------S-
A9QXG9_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2K5NZS5_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A0D9S017_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2K6CIX3_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2K5XRD4_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2K6KHG1_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2K6R2I6_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2K5HK49_BCL2-01      ------------GWDAFVELYGP-----------SMWPLFDF------S-
G3QES9_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2I3GZF9_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2K6UEL3_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
P10415_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
P10415_BCL2-02          ------------GWDAFVELYGP-----------SMRPLFDF------S-
H2QEM8_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A2U4BHU7_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
Q75SV7_BCL2-01          ------------GWDAFVELYGP-----------TMQPLFDF------S-
M3X1R9_BCL2-01          ------------GWDAFVELYGP-----------SMQPLFDF------S-
A0A076FU27_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
F6R2C4_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
O02718_BCL2-01          ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A076FZV9_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
A0A452EV13_BCL2-01      ------------GWDAFVELYGP-----------SMRPLFDF------S-
G1LID1_BCL2-01          ------------GWDAFVELYGP-----------SMQPLFDF------S-
A0A452R145_BCL2-01      ------------GWDAFVELYGP-----------SMQPLFDF------S-
G3WZW9_BCL2-02          ------------GWVGVSA-------------------------------
G3ULB7_BCL2-02          ------------GWVGACVVE-----------------------------
A0A452T603_BCL2-01      ------------GWVGARPLECA-----------SGLHVSNL------RL
A0A3P8WUE9_BCL2-01      ------------GWDAFVELYDR-----------QGESAFSC------S-
A0A3Q3G1D7_BCL2-01      ------------GWDAFVELYDR-----------QRDSAFCS------S-
A0A3B4A3G8_BCL2-01      ------------GWEAFVELYDR-----------QRDSVFSC------S-
                                                                          

G1MZW1_BCL2-01          WISLKTILSLVLVG-----AC----ITLGAY-LGHK--------------
A0A287APJ6_BCL2-01      WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
A0A3Q3B0R2_BCL2-01      WPSIKTVFGLAALG-----AAS---ITIGAY-LTQKMPLTPQRQPSDQIW
A0A3Q2PN77_BCL2-01      WPSIKTVFGLAALG-----AAS---ITIGAY-LAQK--------------
A0A1X9JZA1_BCL2-01      WPSIKTVFGVAALG-----AAS---LTIGAY-LTQK--------------
A0A3Q0S5Z7_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3P8QVM8_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3P9DIG5_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3Q2UYW8_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3B4G3K4_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3Q1I5N1_BCL2-01      WSSIKTVFGLAALG-----AAS---LTIGAY-LAQK--------------
A0A3Q3K1K1_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3Q3MEY1_BCL2-01      WPSIKTVFGLAALG-----AAS---ITIGAY-LTQK--------------
A0A3Q1FLK7_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3Q1B8C3_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3P8S9L3_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3B5BBQ0_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3B4TX71_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3B4YAG2_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
Q564A4_BCL2-01          FSYLTKVLGLAALG-----LAG---VTIGAF-FAQK--------------
W5N4F7_BCL2-01          WPSLKTFFGLAALG-----AAG---LTVGAY-FTQK--------------
B9ZYL7_BCL2-01          WLSIKTILSLAVVG-----AC----ITIGGISLATK--------------
A0A452I9V7_BCL2-01      -------------------VC----VQYFFL-FKLQ--------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      WFSEKKNMTWCLTSDKDVIDR----TPIRMY-QGRKSREAEIQSQCRPPC
K7F5Y4_BCL2-02          --------------------------------------------------
K7F5Y4_BCL2-01          WISLKTILSLALVG-----AC----ITLGAY-LGHK--------------
F6YNL8_BCL2-01          WLSLKTLLSLALVG-----AC----VTLGAY-LGHK--------------
H0YUX3_BCL2-01          WISLKTILSLVLVG-----AC----ITLGAY-LGHK--------------
H0W1T3_BCL2-01          ------------VG-----AC----LSE----------------------
J9NXG3_BCL2-02          --------------------------------------------------
G1LID1_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          ------------VG-----AR----RVE----------------------
G1TW27_BCL2-01          WVSLKTLFSLALIG-----AC----ITLGAY-LGHK--------------
P10417_BCL2-02          ------------VG-----AC----LVE----------------------
A0A096MPU7_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
P10417_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
Q7TSN8_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
Q6R755_BCL2-01          WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
Q9JJV8_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGTY-LGHK--------------
Q923R6_BCL2-01          WLSLXTLLNLALVG-----AC----ITLGTY-LGHK--------------
F1LNV0_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
P49950_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
H2NWH5_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A3Q2HRY3_BCL2-01      WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2K6G3I7_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A287APJ6_BCL2-03      WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
H0WKI0_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2K5UDI5_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2K5EB04_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2R8MY14_BCL2-01      WLSLKTLLSLVLVG-----AC----ITLGAY-LGHK--------------
F7BXJ7_BCL2-01          --------------------------------------------------
A0A3B3TCS4_BCL2-01      WPYLKTVFGLAALG-----AVG---VTISAY-FTKK--------------
A0A3P8YNB4_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3P9AAB2_BCL2-01      WPFLKTMFSLAALG-----AAG---VTIGAM-FTQK--------------
A0A0U3DHY6_BCL2-01      WPYLKTVFGLAALG-----AVG---VTIGAL-FTQK--------------
X4ZGI8_BCL2-01          LSYLTKVLGLAALG-----LAG---VTIGAF-FAQK--------------
U3KEW4_BCL2-01          WISLKTILSLVLVG-----AC----ITLGAY-LGHK--------------
Q00709_BCL2-01          WISLKTILSLVLVG-----AC----ITLGAY-LGHK--------------
K7F5Y4_BCL2-03          --------------------------------------------------
G3WZW9_BCL2-01          -------------------------GTKAIC-MGTSGPFQVS--------
A0A452R145_BCL2-02      --------------------------------------------------
M3YYK3_BCL2-01          WPKVFSLLA-----------------------------------------
P10415_BCL2-04          -------------------------LGDVSL-G-----------------
A0A2K6R2I6_BCL2-02      -------------------------CTWCRF-RGCD--------------
J9NXG3_BCL2-01          WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
A0A1D5QRF2_BCL2-01      VRGLECGWAPGARG-----GCGAGEIKSGLL-LPGVPTSSSG--------
A0A2R9APW6_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
G3ULB7_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A9QXG9_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LSHK--------------
A0A2K5NZS5_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A0D9S017_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2K6CIX3_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2K5XRD4_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2K6KHG1_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2K6R2I6_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2K5HK49_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
G3QES9_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2I3GZF9_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2K6UEL3_BCL2-01      WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
P10415_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
P10415_BCL2-02          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
H2QEM8_BCL2-01          WLSLKTLLSLALVG-----AC----ITLGAY-LGHK--------------
A0A2U4BHU7_BCL2-01      WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
Q75SV7_BCL2-01          WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
M3X1R9_BCL2-01          WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
A0A076FU27_BCL2-01      WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
F6R2C4_BCL2-01          WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
O02718_BCL2-01          WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
A0A076FZV9_BCL2-01      WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
A0A452EV13_BCL2-01      WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
G1LID1_BCL2-01          WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
A0A452R145_BCL2-01      WLSLKALLSLALVG-----AC----ITLGAY-LGHK--------------
G3WZW9_BCL2-02          --------------------------------------------------
G3ULB7_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      RIRGWSVGGLLGQG-----QTDEPGK------------------------
A0A3P8WUE9_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3Q3G1D7_BCL2-01      WPSIKTVFGLAALG-----AAS---LTIGAY-LTQK--------------
A0A3B4A3G8_BCL2-01      WPSIKTVFGLAAIG-----AAS---LTIGAY-LSQK--------------
                                                                          

G1MZW1_BCL2-01          ---------------------------------------------
A0A287APJ6_BCL2-01      ---------------------------------------------
A0A3Q3B0R2_BCL2-01      LSSKPRSENCFPPPAPPCQNRHKSKQQREPEARPREQRMSEVESH
A0A3Q2PN77_BCL2-01      ---------------------------------------------
A0A1X9JZA1_BCL2-01      ---------------------------------------------
A0A3Q0S5Z7_BCL2-01      ---------------------------------------------
A0A3P8QVM8_BCL2-01      ---------------------------------------------
A0A3P9DIG5_BCL2-01      ---------------------------------------------
A0A3Q2UYW8_BCL2-01      ---------------------------------------------
A0A3B4G3K4_BCL2-01      ---------------------------------------------
A0A3Q1I5N1_BCL2-01      ---------------------------------------------
A0A3Q3K1K1_BCL2-01      ---------------------------------------------
A0A3Q3MEY1_BCL2-01      ---------------------------------------------
A0A3Q1FLK7_BCL2-01      ---------------------------------------------
A0A3Q1B8C3_BCL2-01      ---------------------------------------------
A0A3P8S9L3_BCL2-01      ---------------------------------------------
A0A3B5BBQ0_BCL2-01      ---------------------------------------------
A0A3B4TX71_BCL2-01      ---------------------------------------------
A0A3B4YAG2_BCL2-01      ---------------------------------------------
Q564A4_BCL2-01          ---------------------------------------------
W5N4F7_BCL2-01          ---------------------------------------------
B9ZYL7_BCL2-01          ---------------------------------------------
A0A452I9V7_BCL2-01      ---------------------------------------------
H9GPE7_BCL2-01          ---------------------------------------------
A0A3Q2HRY3_BCL2-02      MLLHLLEIQVPVLFLSE----------------------------
K7F5Y4_BCL2-02          ---------------------------------------------
K7F5Y4_BCL2-01          ---------------------------------------------
F6YNL8_BCL2-01          ---------------------------------------------
H0YUX3_BCL2-01          ---------------------------------------------
H0W1T3_BCL2-01          ---------------------------------------------
J9NXG3_BCL2-02          ---------------------------------------------
G1LID1_BCL2-02          ---------------------------------------------
I3MVK9_BCL2-01          ---------------------------------------------
G1TW27_BCL2-01          ---------------------------------------------
P10417_BCL2-02          ---------------------------------------------
A0A096MPU7_BCL2-01      ---------------------------------------------
P10417_BCL2-01          ---------------------------------------------
Q7TSN8_BCL2-01          ---------------------------------------------
Q6R755_BCL2-01          ---------------------------------------------
Q9JJV8_BCL2-01          ---------------------------------------------
Q923R6_BCL2-01          ---------------------------------------------
F1LNV0_BCL2-01          ---------------------------------------------
P49950_BCL2-01          ---------------------------------------------
H2NWH5_BCL2-01          ---------------------------------------------
A0A3Q2HRY3_BCL2-01      ---------------------------------------------
A0A2K6G3I7_BCL2-01      ---------------------------------------------
A0A287APJ6_BCL2-03      ---------------------------------------------
H0WKI0_BCL2-01          ---------------------------------------------
A0A2K5UDI5_BCL2-01      ---------------------------------------------
A0A2K5EB04_BCL2-01      ---------------------------------------------
A0A2R8MY14_BCL2-01      ---------------------------------------------
F7BXJ7_BCL2-01          ---------------------------------------------
A0A3B3TCS4_BCL2-01      ---------------------------------------------
A0A3P8YNB4_BCL2-01      ---------------------------------------------
A0A3P9AAB2_BCL2-01      ---------------------------------------------
A0A0U3DHY6_BCL2-01      ---------------------------------------------
X4ZGI8_BCL2-01          ---------------------------------------------
U3KEW4_BCL2-01          ---------------------------------------------
Q00709_BCL2-01          ---------------------------------------------
K7F5Y4_BCL2-03          ---------------------------------------------
G3WZW9_BCL2-01          ---------------------------------------------
A0A452R145_BCL2-02      ---------------------------------------------
M3YYK3_BCL2-01          ---------------------------------------------
P10415_BCL2-04          ---------------------------------------------
A0A2K6R2I6_BCL2-02      ---------------------------------------------
J9NXG3_BCL2-01          ---------------------------------------------
A0A1D5QRF2_BCL2-01      ---------------------------------------------
A0A2R9APW6_BCL2-01      ---------------------------------------------
G3ULB7_BCL2-01          ---------------------------------------------
A9QXG9_BCL2-01          ---------------------------------------------
A0A2K5NZS5_BCL2-01      ---------------------------------------------
A0A0D9S017_BCL2-01      ---------------------------------------------
A0A2K6CIX3_BCL2-01      ---------------------------------------------
A0A2K5XRD4_BCL2-01      ---------------------------------------------
A0A2K6KHG1_BCL2-01      ---------------------------------------------
A0A2K6R2I6_BCL2-01      ---------------------------------------------
A0A2K5HK49_BCL2-01      ---------------------------------------------
G3QES9_BCL2-01          ---------------------------------------------
A0A2I3GZF9_BCL2-01      ---------------------------------------------
A0A2K6UEL3_BCL2-01      ---------------------------------------------
P10415_BCL2-01          ---------------------------------------------
P10415_BCL2-02          ---------------------------------------------
H2QEM8_BCL2-01          ---------------------------------------------
A0A2U4BHU7_BCL2-01      ---------------------------------------------
Q75SV7_BCL2-01          ---------------------------------------------
M3X1R9_BCL2-01          ---------------------------------------------
A0A076FU27_BCL2-01      ---------------------------------------------
F6R2C4_BCL2-01          ---------------------------------------------
O02718_BCL2-01          ---------------------------------------------
A0A076FZV9_BCL2-01      ---------------------------------------------
A0A452EV13_BCL2-01      ---------------------------------------------
G1LID1_BCL2-01          ---------------------------------------------
A0A452R145_BCL2-01      ---------------------------------------------
G3WZW9_BCL2-02          ---------------------------------------------
G3ULB7_BCL2-02          ---------------------------------------------
A0A452T603_BCL2-01      ---------------------------------------------
A0A3P8WUE9_BCL2-01      ---------------------------------------------
A0A3Q3G1D7_BCL2-01      ---------------------------------------------
A0A3B4A3G8_BCL2-01      ---------------------------------------------
                                                                     

© 1998-2019