Dataset for protein BCL-2-like of organism Xiphophorus maculatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5PQ55_MCL1-02      MTANSTNALNYLI-------------FSQNGVGNGQTHYDQGLGVPEVAM
A0A3B5PQ55_MCL1-01      MTANSTNALNYLI-------------FSQNGVGNGQTHYDQGLGVPEVAM
M4AUW7_BCL2L10-01       ---------------------------------MSCGLWKETVVVAE---
A0A3B5PQJ0_BCL2L1-      -MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDGTA--AGDVGMDD---
M4A558_BCL2L1-01        MAYSNRELVEFYISYKLSQRNYS-SSLLRSEVAGGRTNWEGDSRVPS---
                                                          .         : .   

A0A3B5PQ55_MCL1-02      GSTVESLHSPKDPFMKRPTNLGVNGYVAKSLPTSSDDSDEGSLPCTPAQH
A0A3B5PQ55_MCL1-01      GSTVESLHSPKDPFMKRPTNLGVNGYVAKSLPTSSDDSDEGSLPCTPAQH
M4AUW7_BCL2L10-01       ---------------------------DYIRLRCSSPHPAPPPPSEPA--
A0A3B5PQJ0_BCL2L1-      ---------------------------EQTLETHANGTFNGTSPGSPRRH
M4A558_BCL2L1-01        ---------------------------NGRLVNSRAG-----PPGKPR--
                                                                   *  *   

A0A3B5PQ55_MCL1-02      PDSEKDATAVGASNQVLDNDTTELISSFLRDFTGLSKCRWGQNKALSTMK
A0A3B5PQ55_MCL1-01      PDSEKDATAVGASNQVLDNDTTELISSFLRDFTGLSKCRWGQNKALSTMK
M4AUW7_BCL2L10-01       ----------------------------------------------AAMR
A0A3B5PQJ0_BCL2L1-      QAASASTMDA----------------------------------VKVALR
M4A558_BCL2L1-01        --GPMAGVEV----------------------------------VKSVLK
                                                                       .:.

A0A3B5PQ55_MCL1-02      RVVEDLLSKHKYAYNGMVNRLALDNEPDDMEFVTEIAESLFSDGITNWGR
A0A3B5PQ55_MCL1-01      RVVEDLLSKHKYAYNGMVNRLALDNEPDDMEFVTEIAESLFSDGITNWGR
M4AUW7_BCL2L10-01       RLAQDVEAKHQARFHSLAQGFLKHCGSDLCSNLRKVMDEMVGDGHFNWGR
A0A3B5PQJ0_BCL2L1-      DTAREFELRYSRAFNDLHST-LHITPATAYQSFENVMDEVFRDG-VNWGR
M4A558_BCL2L1-01        DAAEEFERLYTQSFKHLSLQ-LDITPDTAYHSFKTVLDELFKGG-VNWGR
                          . :.   :   :: :               .  : :.:. .*  ****

A0A3B5PQ55_MCL1-02      IASLVTFGAAVCQRLKERGREHCVE----------------LVSRKISTY
A0A3B5PQ55_MCL1-01      IASLVTFGAAVCQRLKERGREHCVE----------------LVSRKISTY
M4AUW7_BCL2L10-01       VVSLFAFAGVLARQLREQTGKNPVPDSGKQQELQQEPVSCRALAETIADY
A0A3B5PQJ0_BCL2L1-      IVGLFAFGGALCVECVEKEMSHLVA----------------RIVEWMTVY
M4A558_BCL2L1-01        VVAMFTFGGILCVDCVQKNMSELVS----------------RIAEWMTTY
                        :..:.:*.. :.    :.  .  *                  :   :: *

A0A3B5PQ55_MCL1-02      LLANQRDWLAKNNSWEGFVEFFRV----SDPESTVRNTLMAVVGVAGIGA
A0A3B5PQ55_MCL1-01      LLANQRDWLAKNNSWEGFVEFFRV----SDPESTVRNTLMAVVGVAGIGA
M4AUW7_BCL2L10-01       LEKHKKDWLQENNGWEGFCS-YARNAREASQDSSMKTALVAVAGVGIAGL
A0A3B5PQJ0_BCL2L1-      LDEQIEPWVESQGGWERFAEIFGGNA--AAESRRSQESFKNWLLLGMSVV
M4A558_BCL2L1-01        LDEQLSPWIQSQGGWDRFANLYGQDA--AAEGRRFRETLNKWLLVGVALL
                        *  :   *: .:..*: * . :      :      . ::     :.    

A0A3B5PQ55_MCL1-02      TLAFLI-----SF-
A0A3B5PQ55_MCL1-01      TLAFLIRRCKEKY-
M4AUW7_BCL2L10-01       TFLLVR--------
A0A3B5PQJ0_BCL2L1-      TAFIAGSIFAQKRL
M4A558_BCL2L1-01        TGALLVVFVAKKR-
                        *  :          

© 1998-2019