Dataset for protein Bcl-xL of organism Xiphophorus maculatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5PQJ0_BCL2L1-      -MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDGTA--AGDVGMDDEQT
M4A558_BCL2L1-01        MAYSNRELVEFYISYKLSQRNYS-SSLLRSEVAGGRTNWEGDSRVPSNGR
                            ***** ***.:*******. . :* .* ..* :   **  : .:  

A0A3B5PQJ0_BCL2L1-      LETHANGTFNGTSPGSPRRHQAASASTMDAVKVALRDTAREFELRYSRAF
M4A558_BCL2L1-01        LVNSRAG-----PPGKPR----GPMAGVEVVKSVLKDAAEEFERLYTQSF
                        * .   *     .**.**    .. : ::.** .*.*:* ***  *:.:*

A0A3B5PQJ0_BCL2L1-      NDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECV
M4A558_BCL2L1-01        KHLSLQLDITPDTAYHSFKTVLDELFKGGVNWGRVVAMFTFGGILCVDCV
                        : *   * *** ***:**:.*:**:*..******:*.:*:*** ***:**

A0A3B5PQJ0_BCL2L1-      EKEMSHLVARIVEWMTVYLDEQIEPWVESQGGWERFAEIFGGNAAAESRR
M4A558_BCL2L1-01        QKNMSELVSRIAEWMTTYLDEQLSPWIQSQGGWDRFANLYGQDAAAEGRR
                        :*:** **:**.****.*****:.**::*****:***:::* :****.**

A0A3B5PQJ0_BCL2L1-      SQESFKNWLLLGMSVVTAFIAGSIFAQKRL
M4A558_BCL2L1-01        FRETLNKWLLVGVALLTGALLVVFVAKKR-
                         .*::::***:*::::*. :   :.*:** 

© 1998-2019