Dataset for protein BCL-2-like of organism Xiphophorus couchianus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5MGS2_BCL2L1-      MAYSNRELVEFYISYKLSQRNYSSSLLRSEVAGGRTNWEGDSRVPRNGPL
A0A3B5MJ12_BCL2L10      ---------------------MSCGL-----------WKETVVVAEDYIR
                                              *..*           *:    *. :   

A0A3B5MGS2_BCL2L1-      VNSWAGHPGKPRGPPAGVEVVKSVLKDAAEEFERLYTQSFKHLSLQ-LDI
A0A3B5MJ12_BCL2L10      LRCSSPHPAPP--PPSEPA---AAMRRLAQDVEAKHQARFHSLAQGFLKH
                        :.. : **. *  **:      :.:.  *::.*  :   *: *:   *. 

A0A3B5MGS2_BCL2L1-      TPDTAYHSFKTVLDELF-KGGVNWGRVVAMFTFGGILCVDCVQKNMSELV
A0A3B5MJ12_BCL2L10      CGSDLCSNLRKVMDEMVGDGHFNWGRVVSLFAFAGVLARQLREQTGKNPV
                          .    .:..*:**:. .* .******::*:*.*:*. :  ::. .: *

A0A3B5MGS2_BCL2L1-      S----------------RIAEWMTTYLDEQLSPWIQSQGGWDRFANLYGQ
A0A3B5MJ12_BCL2L10      PDSGKQQELQQEPVSCRALAETIADYLEKHKKDWLQENNGWEGFCS-YAR
                        .                 :** :: **::: . *:*.:.**: *.. *..

A0A3B5MGS2_BCL2L1-      DAAAEGRRFRETLNKWLLVGVALLTGALLVVFVAKKR
A0A3B5MJ12_BCL2L10      NAREASQDSSMKTALVAVAGVGIAGLTFLLV-----R
                        :*   ..    .     :.**.:   ::*:*     *

© 1998-2019