Dataset for protein BCL-2-like of organism Xenopus tropicalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7ETY1_MCL1-01        MMRQSVIAKQRTSAGFLIPCQFYCSGGGGGNASE---KAVNDRGASPWDA
F6TEC3_BCL2L2-01      RKKGNNGVKDRDWEEQHATGNIIFRGSPDKYLTEQGWMAQSELGS---RA
Q6GLI5_BCL2L1-01      -------------------------------------MEGSS------RD
F7BXJ7_BCL2-01        -------------------------------------MAHPRRGGYDHRD
Q5XGJ4_BCL2L2-01      -------------------------------------MAQSELGS---RA
                                                                        

F7ETY1_MCL1-01        DMEAH-RDKLDRPQLNGFGFNSGGSLTASQEGELDEDIDGGSQGSSSPPD
F6TEC3_BCL2L2-01      LVEDFVRYKLCQRSL--------------------------------VPE
Q6GLI5_BCL2L1-01      LVEKFVCKKLSQKGA----------------CGEFSSNSQPKGVSNGSSE
F7BXJ7_BCL2-01        IVVKYIHYKLSQKGYEWEEGRQQVSAEHPQASAAISNYSDDGEMPAASAD
Q5XGJ4_BCL2L2-01      LVEDFVRYKLCQRSL--------------------------------VPE
                       :  .   ** .                                    .:

F7ETY1_MCL1-01        SPVCPKDGLYMDTQQLILAFFRGYCGEETSGLKAS---FLLHHGAHPKAL
F6TEC3_BCL2L2-01      PA-----------------------GAASCSLHSA---------------
Q6GLI5_BCL2L1-01      GP-----------------------GATQGIVGEE-------------VL
F7BXJ7_BCL2-01        SR-----------------------GPPQSSLASAAASSAAMQPVPPAVL
Q5XGJ4_BCL2L2-01      PA-----------------------GAASCSLHSA---------------
                                               *     :                  

F7ETY1_MCL1-01        ETLQRVGGDIIEKHHMAFTGMLQRLSIHSREDLQKLSEVPALVFNDGVTN
F6TEC3_BCL2L2-01      --MRAAGDEFEERFRQAFSEISTQIHVTPGTAYARFAEVAGSLFQGGV-N
Q6GLI5_BCL2L1-01      QALLDASEEFELRYQRAFSDLTAQLHLTQDTAQQSFQQVVGELFRDGT-N
F7BXJ7_BCL2-01        QTLSRAGDEFSRLYQQDFRQISGLLHLTPSTVRVRFATVVEELFHDGV-N
Q5XGJ4_BCL2L2-01      --MRAAGDEFEERFRQAFSEISTQIHVTPGTAYARFAEVAGSLFQGGV-N
                        :  .. ::   ..  *  :   : :        :  *   :*..*. *

F7ETY1_MCL1-01        WGRIVTVISFGAFVAKHLKSIDLEDCIMALAEHFTLFLMTSKKDWIIQEK
F6TEC3_BCL2L2-01      WGRIVAFFVFGAALCAESVNKEMSPLLPRIQDWMVTYLETNLRDWIQSNG
Q6GLI5_BCL2L1-01      WGRIVAFFSFGRALCVESANKEMTELLPRIVQWMVQYLEHTLQPWMLENG
F7BXJ7_BCL2-01        WGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNSHLQNWIQEQG
Q5XGJ4_BCL2L2-01      WGRIVAFFVFGAALCAESVNKEMSPLLPRIQDWMVTYLETNLRDWIQSNG
                      *****:.: **  :.    . ::   :  :  .:. :*    . *: .: 

F7ETY1_MCL1-01        GWEGFVDFFHIEDYES----------GLRTVLMAFSSVAVLGAGLAFMIR
F6TEC3_BCL2L2-01      GWNGFLTLYGDGAIEEARRQREGNWASLKTVLTGAVALGALMTVGALFAS
Q6GLI5_BCL2L1-01      GWEAFVGLYGKGAAAQSREGPE----RFGRWLMAIVTVTAATLLVSYLRR
F7BXJ7_BCL2-01        GW------------------------------------------------
Q5XGJ4_BCL2L2-01      GWNGFLTLYGDGAIEEARRQREGNWASLKTVLTGAVALGALMTVGALFAS
                      **                                                

F7ETY1_MCL1-01        -
F6TEC3_BCL2L2-01      K
Q6GLI5_BCL2L1-01      R
F7BXJ7_BCL2-01        -
Q5XGJ4_BCL2L2-01      K
                       

© 1998-2019