Dataset for protein Bcl-w of organism Xenopus tropicalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6TEC3_BCL2L2-01      RKKGNNGVKDRDWEEQHATGNIIFRGSPDKYLTEQGWMAQSELGSRALVE
Q5XGJ4_BCL2L2-01      -------------------------------------MAQSELGSRALVE
                                                           *************

F6TEC3_BCL2L2-01      DFVRYKLCQRSLVPEPAGAASCSLHSAMRAAGDEFEERFRQAFSEISTQI
Q5XGJ4_BCL2L2-01      DFVRYKLCQRSLVPEPAGAASCSLHSAMRAAGDEFEERFRQAFSEISTQI
                      **************************************************

F6TEC3_BCL2L2-01      HVTPGTAYARFAEVAGSLFQGGVNWGRIVAFFVFGAALCAESVNKEMSPL
Q5XGJ4_BCL2L2-01      HVTPGTAYARFAEVAGSLFQGGVNWGRIVAFFVFGAALCAESVNKEMSPL
                      **************************************************

F6TEC3_BCL2L2-01      LPRIQDWMVTYLETNLRDWIQSNGGWNGFLTLYGDGAIEEARRQREGNWA
Q5XGJ4_BCL2L2-01      LPRIQDWMVTYLETNLRDWIQSNGGWNGFLTLYGDGAIEEARRQREGNWA
                      **************************************************

F6TEC3_BCL2L2-01      SLKTVLTGAVALGALMTVGALFASK
Q5XGJ4_BCL2L2-01      SLKTVLTGAVALGALMTVGALFASK
                      *************************

© 1998-2019