Dataset for protein BCL-2-like of organism Xenopus laevis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2TAP5_BCL2L1-01      --------------------------MEGSSRDLVEKFVSKKLSQNEAC-
Q91828_BCL2L1-01      --------------------------MEGSSRDLVEKFVSKKLSQNEAC-
B6V6J0_MCL1-01        MMHQSVIAKQRPSTSFLIPCQFYCSGGGSSEKTLSAR--------GASPW
B9ZYL7_BCL2-01        --------------------MAHPRRGGYDHRDIVVKYIHYKLSQKGYAW
                                                   . . :  .             

Q2TAP5_BCL2L1-01      --------------------------------------------------
Q91828_BCL2L1-01      --------------------------------------------------
B6V6J0_MCL1-01        D---PDMDTHRPQLNGL--GFNNGGSLPCSQEDELDEDMDNGSQGSTSPP
B9ZYL7_BCL2-01        EEGRQQVSAEHPQASAAISNYSDDGEMPAASADSRGPPQSSLASAASSDE
                                                                        

Q2TAP5_BCL2L1-01      -----------------------------------RKFSNNPQPNAISNG
Q91828_BCL2L1-01      -----------------------------------RKFSNNPNPMPYLME
B6V6J0_MCL1-01        DSP---------------------VCPKDGLYMDTQQLILA--FYRVYSG
B9ZYL7_BCL2-01        ETPSNTPITFVGNAPAVPRRSASAVSPLAELNVEPRDLNVNPDASRAADG
                                                         ..:            

Q2TAP5_BCL2L1-01      TSTSERPGEGATQGIVEEEVLQALLEATEEFELRYQRAFSDLTSQLHITQ
Q91828_BCL2L1-01      PSTSERPGEGATQGIVEEEVLQALLEATEEFELRYQRAFSDLTSQLHITQ
B6V6J0_MCL1-01        EESGELEASCLLQHGVHHKALETLLRVGGEIIEKHHMAFTGMLQRLSIHS
B9ZYL7_BCL2-01        DNNDADGGDEAVMQPVPSAVLQTLSRAGDEFSRLYQQDFRQISGLLHLTP
                       ...   ..      *   .*::*  .  *:   ::  *  :   * :  

Q2TAP5_BCL2L1-01      DTAQQSFQQVMGELFRDGT-NWGRIVAFFSFGRALCVESANKEMTDLLPR
Q91828_BCL2L1-01      DTAQQSFQQVMGELFRDGT-NWGRIVAFFSFGRALCVESANKEMTDLLPR
B6V6J0_MCL1-01        REDLQKLSEVPALVFNDGVTNWGRIVTVISFGAFVAKHLKSLNLEDCIGV
B9ZYL7_BCL2-01        STVRVRFATVVEELFHDGV-NWGRIVAFFEFGGVMCVEIVNREMSPLVDS
                            :  *   :*.**. ******:.:.**  :.    . ::   :  

Q2TAP5_BCL2L1-01      IVQWMVNYLEHTLQPWMQENGGWEAFVGLYGKNAAAQSRESQERFGRLLT
Q91828_BCL2L1-01      IVQWMVNYLEHTLQPWMQENGGWEAFVGLYGKNAAAQSRESQERFGRLLT
B6V6J0_MCL1-01        LAEHFTQFLMMSKKDWIIQEKGWDGFVDFFH------IEDYESGLKTVL-
B9ZYL7_BCL2-01        IVGWMTEYLNRHLQNWIQEQ---DAFVELYNSNIQPPFDQSWLSIKTILS
                      :. .:.::*    : *: ::   :.** ::         :    :  :* 

Q2TAP5_BCL2L1-01      IVILTGVFAL--VCYMRRR
Q91828_BCL2L1-01      IVMLTGVFAL--VCYMRRR
B6V6J0_MCL1-01        MAFSSVAVLGAGLAYMIR-
B9ZYL7_BCL2-01        LAVVGACITIGGISLATK-
                      :..    .    :.   . 

© 1998-2019