Dataset for protein Bcl-xL of organism Xenopus laevis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2TAP5_BCL2L1-01      MEGSSRDLVEKFVSKKLSQNEACRKFSNNPQPNAISNGTSTSERPGEGAT
Q91828_BCL2L1-01      MEGSSRDLVEKFVSKKLSQNEACRKFSNNPNPMPYLMEPSTSERPGEGAT
                      ******************************:* .    .***********

Q2TAP5_BCL2L1-01      QGIVEEEVLQALLEATEEFELRYQRAFSDLTSQLHITQDTAQQSFQQVMG
Q91828_BCL2L1-01      QGIVEEEVLQALLEATEEFELRYQRAFSDLTSQLHITQDTAQQSFQQVMG
                      **************************************************

Q2TAP5_BCL2L1-01      ELFRDGTNWGRIVAFFSFGRALCVESANKEMTDLLPRIVQWMVNYLEHTL
Q91828_BCL2L1-01      ELFRDGTNWGRIVAFFSFGRALCVESANKEMTDLLPRIVQWMVNYLEHTL
                      **************************************************

Q2TAP5_BCL2L1-01      QPWMQENGGWEAFVGLYGKNAAAQSRESQERFGRLLTIVILTGVFALVCY
Q91828_BCL2L1-01      QPWMQENGGWEAFVGLYGKNAAAQSRESQERFGRLLTIVMLTGVFALVCY
                      ***************************************:**********

Q2TAP5_BCL2L1-01      MRRR
Q91828_BCL2L1-01      MRRR
                      ****

© 1998-2019