Dataset for protein BCL-2-like of organism Ursus maritimus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A384D3U1_BCL2L1-      ------MSQSNR--------------------------------------
A0A452T603_BCL2-01      MAHAGRTGYDNR--------------------------------------
A0A452U2H8_BCL2A1-      -MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGY
A0A452U2H8_BCL2A1-      -MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGY
A0A384DPS8_BCL2L2-      -MATPASAPDTR--------------------------------------
A0A384DPS8_BCL2L2-      -MATPASAPDTR--------------------------------------
A0A384DPS8_BCL2L2-      -MATPASAPDTR--------------------------------------
                                 . *                                      

A0A384D3U1_BCL2L1-      --ELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGN
A0A452T603_BCL2-01      --EIVMKYIHYKLSQRGY--------------------------------
A0A452U2H8_BCL2A1-      TLTLAQDYVKHVLQ------------------------------------
A0A452U2H8_BCL2A1-      TLTLAQDYVKHVLQ------------------------------------
A0A384DPS8_BCL2L2-      --ALVADFVGYKLRQKGY--------------------------------
A0A384DPS8_BCL2L2-      --ALVADFVGYKLRQKGY--------------------------------
A0A384DPS8_BCL2L2-      --ALVADFVGYKLRQKGY--------------------------------
                           :. .:: : *                                     

A0A384D3U1_BCL2L1-      PSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRA
A0A452T603_BCL2-01      -----------------DPVPP--------VVHLTLRQAGDDFSRRYRRD
A0A452U2H8_BCL2A1-      ---------IPQPGSAPSRASQ--------VLRDVASSVQGEVEKNLKPC
A0A452U2H8_BCL2A1-      ---------IPQPGSAPSRASQ--------VLRDVASSVQGEVEKNLKPC
A0A384DPS8_BCL2L2-      ---------VCGAGPGEGPAAD--------PLHQAMRAAGDEFETRFRRT
A0A384DPS8_BCL2L2-      ---------VCGAGPGEGPAAD--------PLHQAMRAAGDEFETRFRRT
A0A384DPS8_BCL2L2-      ---------VCGAGPGEGPAAD--------PLHQAMRAAGDEFETRFRRT
                                         .             :. .   . .:.. . .  

A0A384D3U1_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVE
A0A452T603_BCL2-01      FAEMSSQLHLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVE
A0A452U2H8_BCL2A1-      LDSFDV---VSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKK
A0A452U2H8_BCL2A1-      LDSFDV---VSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKK
A0A384DPS8_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
A0A384DPS8_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
A0A384DPS8_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
                        : .:     ::  :*   *  * :: * .*  ****:*::* * . :  :

A0A384D3U1_BCL2L1-      SVDKEMQVLV--SRIATWMATYLNDHLEPWIQENGGWD-TFVELYGNNAA
A0A452T603_BCL2-01      SVNREMSPLV--DNIALWMTEYLNRHLHTWIQDNGGWVGARPLECASGLH
A0A452U2H8_BCL2A1-      LLQERISPDVDASRISYFVAEFITTNMREWIRQNGGWSLLPPSASVKGCK
A0A452U2H8_BCL2A1-      LLQERISPDVDASRISYFVAEFITTNMREWIRQNGGWE----DGFVKKFE
A0A384DPS8_BCL2L2-      SVNKEMEPLV--GQVQEWMVAYLETRLADWIHSSGGWA-EFTALYGDGAL
A0A384DPS8_BCL2L2-      SVNKEMEPLV--GQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREME
A0A384DPS8_BCL2L2-      SVNKEMEPLV--GQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREME
                         ::  :.  *  ..:  ::. ::  .:  **...***             

A0A384D3U1_BCL2L1-      AESRKGQE------------------------------------------
A0A452T603_BCL2-01      VSNLRLRI---------------------------------RGWSVGGLL
A0A452U2H8_BCL2A1-      RRAPGRSE------------------------------------------
A0A452U2H8_BCL2A1-      PKSGWLTF------------------------------------------
A0A384DPS8_BCL2L2-      EEARRLRE---------------GNWASV------------RTVLTGAVA
A0A384DPS8_BCL2L2-      EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
A0A384DPS8_BCL2L2-      EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
                                                                          

A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452T603_BCL2-01      GQGQTDEPGK----------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
A0A384DPS8_BCL2L2-      LGALVT--------------------------------------------
A0A384DPS8_BCL2L2-      YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSL
A0A384DPS8_BCL2L2-      YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSL
                                                                          

A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
A0A452U2H8_BCL2A1-      --------------------------------------------------
A0A384DPS8_BCL2L2-      --------------------------------------------------
A0A384DPS8_BCL2L2-      ALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF
A0A384DPS8_BCL2L2-      ALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF
                                                                          

A0A384D3U1_BCL2L1-      -RFNRWFLTGMTVAGVVLLGSLFSRK
A0A452T603_BCL2-01      --------------------------
A0A452U2H8_BCL2A1-      -----RRAAATFSAGSSVRE------
A0A452U2H8_BCL2A1-      -----LEVMGKICEMFSLLKQYY---
A0A384DPS8_BCL2L2-      ------------------VGAFFASK
A0A384DPS8_BCL2L2-      YSGFNSRPRGRVYRGRARATSWFL--
A0A384DPS8_BCL2L2-      YSGFNSRPRGRVYRGRARATSWYSPY
                                                  

© 1998-2019