Dataset for protein Bfl1 of organism Ursus maritimus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452U2H8_BCL2A1-      MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYT
A0A452U2H8_BCL2A1-      MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYT
                        **************************************************

A0A452U2H8_BCL2A1-      LTLAQDYVKHVLQIPQPGSAPSRASQVLRDVASSVQGEVEKNLKPCLDSF
A0A452U2H8_BCL2A1-      LTLAQDYVKHVLQIPQPGSAPSRASQVLRDVASSVQGEVEKNLKPCLDSF
                        **************************************************

A0A452U2H8_BCL2A1-      DVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERIS
A0A452U2H8_BCL2A1-      DVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERIS
                        **************************************************

A0A452U2H8_BCL2A1-      PDVDASRISYFVAEFITTNMREWIRQNGGWSLLPPSASVKGCKRRAPGRS
A0A452U2H8_BCL2A1-      PDVDASRISYFVAEFITTNMREWIRQNGGWE----DGFVKKFEPKSGWLT
                        ******************************.    .. **  : .:   :

A0A452U2H8_BCL2A1-      ERRAAATFSAGSSVRE---
A0A452U2H8_BCL2A1-      FLEVMGKICEMFSLLKQYY
                           . ..:.   *: :   

© 1998-2019