Dataset for protein BCL-2-like of organism Ursus americanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452RHX5_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGAASSGGRLLASGKEATARREVGG
A0A452SDS4_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
A0A452R145_BCL2-02      --------------------------------------------------
A0A452R145_BCL2-01      --------------------------------------------------
                                                                          

A0A452RHX5_MCL1-01      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPRLLFLE
A0A452SDS4_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADS
A0A452SHI1_BCL2L2-      ----------------------MATPASAPDTRALVADFVGYKLRQKGY-
A0A452SIR9_BCL2A1-      -------------------MTDCEFGYTLTLAQDYVKHVLQIPQ------
A0A452QJG0_BCL2L10      ----------------MADALRERTARLLTDYLEYCAREPGTPARAP---
A0A452R145_BCL2-02      -----------------MPETRAPRPRGPPPRRASSPPSLGSPPRPPGPR
A0A452R145_BCL2-01      -----------------MPETRAPRPRGPPPRRASSPPSLGSPPRPPGPR
                                                                          

A0A452RHX5_MCL1-01      PTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A452SDS4_BCL2L1-      PAVNGATGHSSSLDAREVIPMAA--VK-----------------------
A0A452SHI1_BCL2L2-      -----------VCGAGPGEGPAADPLH-----------------------
A0A452SIR9_BCL2A1-      ---PGSAPSRASQVLRDVASSVQGEVE-----------------------
A0A452QJG0_BCL2L10      -----------STPEAAVLRSVAAQVQ-----------------------
A0A452R145_BCL2-02      RLPPPAAPAAAAAAAGPALSPVPPVVH-----------------------
A0A452R145_BCL2-01      RLPPPAAPAAAAAAAGPALSPVPPVVH-----------------------
                                                 :                        

A0A452RHX5_MCL1-01      SGGPCTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLG
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
A0A452R145_BCL2-02      --------------------------------------------------
A0A452R145_BCL2-01      --------------------------------------------------
                                                                          

A0A452RHX5_MCL1-01      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A452SDS4_BCL2L1-      ----------QALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
A0A452SHI1_BCL2L2-      ----------QAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVS
A0A452SIR9_BCL2A1-      ----------KNLKPCLDSF------DVVSVDS--------ARTIFNQVM
A0A452QJG0_BCL2L10      ----------QRHEHFLSDY-RGYGGNRVELVAQVEREILA---------
A0A452R145_BCL2-02      ----------LTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
A0A452R145_BCL2-01      ----------LTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
                                         .            :                   

A0A452RHX5_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAE--------
A0A452SDS4_BCL2L1-      NELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAT--------
A0A452SHI1_BCL2L2-      DELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQE--------
A0A452SIR9_BCL2A1-      EKEFEDGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISY------
A0A452QJG0_BCL2L10      ---HPQP-LSWGRVVALLTFAGTLLERSPSGTYSNLGPDQELELGEREAG
A0A452R145_BCL2-02      EELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVDNIAL--------
A0A452R145_BCL2-01      EELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVDNIAL--------
                           .     .***:*::: * . :     .   .                

A0A452RHX5_MCL1-01      ----------SITDVLVRTKRDWLVKQRGWDGFVEFF----------HVE
A0A452SDS4_BCL2L1-      ----------WMATYLNDHLEPWIQENGGWDTFVELYG---NNAAAESRK
A0A452SHI1_BCL2L2-      ----------WMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLRE
A0A452SIR9_BCL2A1-      ----------FVAEFITTNMREWIRQNGGWEDGFVKK----FEPKSGWLT
A0A452QJG0_BCL2L10      VRQDCRHLVDFLCNRLTGQHRAWLEAHDGWVNGFCLF----FTPMLAVRL
A0A452R145_BCL2-02      ----------WMTEYLNRHLHTWIQDNGGWAH------------------
A0A452R145_BCL2-01      ----------WMTEYLNRHLHTWIQDNGGWDAFVELY----GPSMQPLFD
                                   :   :      *:    **                    

A0A452RHX5_MCL1-01      DLEGGIRNVLLAFAGVAGVGAGLAYLIR-
A0A452SDS4_BCL2L1-      GQERFNRWFLTGMT-VAGVVLLGSLFSRK
A0A452SHI1_BCL2L2-      GNWASVRTVLTGAVALGALVTVGAFFASK
A0A452SIR9_BCL2A1-      FLEVTGKICEMFSL-LKQYY---------
A0A452QJG0_BCL2L10      GKDCWPRLFCPASQ-AVILIYFWKRLCEF
A0A452R145_BCL2-02      -----------------------------
A0A452R145_BCL2-01      FSWLSLKALLSLAL-VGACITLGAYLGHK
                                                     

© 1998-2019