Dataset for protein Bcl-2 of organism Ursus americanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452R145_BCL2-02      MPETRAPRPRGPPPRRASSPPSLGSPPRPPGPRRLPPPAAPAAAAAAAGP
A0A452R145_BCL2-01      MPETRAPRPRGPPPRRASSPPSLGSPPRPPGPRRLPPPAAPAAAAAAAGP
                        **************************************************

A0A452R145_BCL2-02      ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
A0A452R145_BCL2-01      ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
                        **************************************************

A0A452R145_BCL2-02      EELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRH
A0A452R145_BCL2-01      EELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRH
                        **************************************************

A0A452R145_BCL2-02      LHTWIQDNGGWAH-------------------------------------
A0A452R145_BCL2-01      LHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGA
                        ***********                                       

A0A452R145_BCL2-02      -----
A0A452R145_BCL2-01      YLGHK
                             

© 1998-2019