Dataset for protein BCL-2-like of organism Tursiops truncatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2U3V2H3_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVG
A0A2U4CFE3_BCL2L2-      --------------------------------------------------
A0A2U3V0P1_BCL2L1-      --------------------------------------------------
A0A2U4BHU7_BCL2-01      --------------------------------------------------
                                                                          

A0A2U3V2H3_MCL1-01      GGEAGEVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATRARLLFF
A0A2U4CFE3_BCL2L2-      ------------------------------MATPASAPDTRALVADFVGY
A0A2U3V0P1_BCL2L1-      -----------------------------------MSQSNRELVVDFLSY
A0A2U4BHU7_BCL2-01      -----------------------------MAHAGRTGYDNREIVMKYIHY
                                                            . .        : :

A0A2U3V2H3_MCL1-01      APTRRASPPEEMESSVSDAIMSPEEELDGCEPEPLGKRPSVLPLLELVGE
A0A2U4CFE3_BCL2L2-      KLRQKGY------VCGAGPGEGPAAD------------P-----------
A0A2U3V0P1_BCL2L1-      KLSQKGYSWSQFSDVDENRTEAPEGT------------ESDMETPSAING
A0A2U4BHU7_BCL2-01      KLSQRGYEW----DAGVAGATSPGAA------------PAPGIFSSQPGS
                           ...               .*                           

A0A2U3V2H3_MCL1-01      ASNSPGKDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPL
A0A2U4CFE3_BCL2L2-      --------------------------------LH----------------
A0A2U3V0P1_BCL2L1-      NPSWHLADSPAVNVATGHSSSLDAREVIPMAAVK----------------
A0A2U4BHU7_BCL2-01      TPAPSRTSPPPPQTAPAAPAGGPALSPVP-PVVH----------------
                                                        :                 

A0A2U3V2H3_MCL1-01      GGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A2U4CFE3_BCL2L2-      -----------QAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A2U3V0P1_BCL2L1-      -----------QALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV
A0A2U4BHU7_BCL2-01      -----------LTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATV
                                    ::* .** .. ..   *  :  :* :.       :  *

A0A2U3V2H3_MCL1-01      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
A0A2U4CFE3_BCL2L2-      SDELFQGGP-NWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLE
A0A2U3V0P1_BCL2L1-      VNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLN
A0A2U4BHU7_BCL2-01      VEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLN
                           :* .*  ****:*::: **. :.    . : .  :  :   :.  * 

A0A2U3V2H3_MCL1-01      RTKRDWLVKQRGWDGFVDFFHVEDLEGG-------------IRNVLLAFA
A0A2U4CFE3_BCL2L2-      TRLADWIHSSGGWAEFTALYGDGALEEA---RRLREGNWASVRTVLTGAV
A0A2U3V0P1_BCL2L1-      DHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFN------RWFLTGMT
A0A2U4BHU7_BCL2-01      RHLHTWIQDNGGWDAFVELYGPSM-------RPLFDFSWLSLKALLSLAL
                             *: .. **  *. ::                      . .*    

A0A2U3V2H3_MCL1-01      GVAGVGAGLAYLIR-
A0A2U4CFE3_BCL2L2-      ALGALVTVGAFFASK
A0A2U3V0P1_BCL2L1-      -VAGVLLLGSLFSRK
A0A2U4BHU7_BCL2-01      -VGACITLGAYLGHK
                         :..     : :   

© 1998-2019