Dataset for protein BCL-2-like of organism Tetraodon nigroviridis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H3CH49_BCL2L1-01      RSHPGAKSKGASTQRMSLNRELVIFYIKYKLSQRNYPLSHIVEPSSRTEG
Q4SW32_MCL1-01        --------MSVIANRTAIDTMNVMFQNGVGDADLSSSQIPMGSPRDAFNG
                               .. ::* :::   *:*      :: . .   : .* .  :*

H3CH49_BCL2L1-01      QFGTTQ-------------------SNGTFNGASPGTPPAPSQHQQSLTS
Q4SW32_MCL1-01        NVGDSPKRPSKLTVVKPKVCLSKTIQEDSEDGSLPCTPESHSGDVLDVSG
                      :.* :                    .:.: :*: * ** : *    .::.

H3CH49_BCL2L1-01      LDAVKEALRDTGN---------------------------------EFEL
Q4SW32_MCL1-01        RPAGDEAALDSDTRQLVSRLMADVTGISRAQWRESRALATTKRVVGDLME
                        * .**  *:..                                 ::  

H3CH49_BCL2L1-01      RYTCAFSDLHNQLHITPATAYQSF-ENVMDEVFRDG-VNWGRIVGLFAFG
Q4SW32_MCL1-01        KHRYTYRGMINKLFMEDRVGDVSFVGAVAKSTFEDGNTNWGRVASLLAFA
                      .:  :: .: *:*.:   ..  **   * ...* ** .****:..*:**.

H3CH49_BCL2L1-01      GALCVECVEKEMNPLVGRIIEWMTVYLDNHIQPWIQSQGGWERFAELFGQ
Q4SW32_MCL1-01        AVVAQYLNDHGQRDCVEQVAQEISTYLLTDQRDWLIKNNAWDGFVEFFQV
                      ..:.    ::  .  * .: : ::.** .  . *: .:..*: *.*:*  

H3CH49_BCL2L1-01      DAAAESRRSQERFRNGLFLGMSLAAGIALGSFIVMR
Q4SW32_MCL1-01        PDPESTVRT-------VLMAVAGVAGIGAKLALLIR
                        . .: *:       :::.:: .***.    :::*

© 1998-2019