Dataset for protein BCL-2-like of organism Tarsius syrichta

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEASEGTESEM
A0A1U7UZD8_BCL2L10      MADPLEERTAR-LLADYLEYCARP--------------------------
A0A1U7UJF2_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGY-----------------------
A0A1U7UJF2_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGY-----------------------
                                                                          

A0A1U7T4L4_BCL2L1-      ----------MWKRTGLRPQKG----------------------------
A0A1U7T4L4_BCL2L1-      ETPSAVNGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGD
A0A1U7UZD8_BCL2L10      ----------------PGSPEP-------------RPSSPEAAVLRSTA-
A0A1U7UJF2_BCL2L2-      -------------VCGAGPGEG-------------PAADPLHQAMRAAGD
A0A1U7UJF2_BCL2L2-      -------------VCGAGPGEG-------------PAADPLHQAMRAAGD
                                          . :                             

A0A1U7T4L4_BCL2L1-      -LSRRWRPPVPSMATH----PGTAYQSFEQVVNELFRDGVN--WGRIVAF
A0A1U7T4L4_BCL2L1-      EFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVN--WGRIVAF
A0A1U7UZD8_BCL2L10      ---ARLRQRHASFFSAFVDYPGSRVDLTARMADAVLSGSRDLSWGRVVTL
A0A1U7UJF2_BCL2L2-      EFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPN--WGRLVAF
A0A1U7UJF2_BCL2L2-      EFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPN--WGRLVAF
                            * *   ..: :     **:  :   .: : :: .. :  ***:*::

A0A1U7T4L4_BCL2L1-      FSF-------GGALCVESVDKEMQVL-------VSRIATWMATYLNDHLE
A0A1U7T4L4_BCL2L1-      FSF-------GGALCVESVDKEMQVL-------VSRIATWMATYLNDHLE
A0A1U7UZD8_BCL2L10      VTFAGTLLERGPLLPAGGQQRGFRPRRKKEEGDVARDCQRLVALLSARLA
A0A1U7UJF2_BCL2L2-      FVF-------GAALCAESVNKEMEPL-------VGQVQEWMVAYLETRLA
A0A1U7UJF2_BCL2L2-      FVF-------GAALCAESVNKEMEPL-------VGQVQEWMVAYLETRLA
                        . *       *  * . . :. :          *..   .:.: *. .* 

A0A1U7T4L4_BCL2L1-      P----WIQDNGGWD-TFVELYGNNAAAESRKGQERFN-------------
A0A1U7T4L4_BCL2L1-      P----WIQDNGGWD-TFVELYGNNAAAESRKGQERFN-------------
A0A1U7UZD8_BCL2L10      GRHRAWLQAQGGWD------------------------------------
A0A1U7UJF2_BCL2L2-      D----WIHSSGGWA-EFTALYGDGALEEARRLRE---------------G
A0A1U7UJF2_BCL2L2-      D----WIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPG
                             *:: .***                                     

A0A1U7T4L4_BCL2L1-      -----------------RWFLTGMTVAGVVL-------------------
A0A1U7T4L4_BCL2L1-      -----------------RWFLTGMTVAGVVL-------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      NWASV------------RTVLTGAVALGALVT------------------
A0A1U7UJF2_BCL2L2-      NAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTIL
                                                                          

A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      CDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGI
                                                                          

A0A1U7T4L4_BCL2L1-      --------------------------------------------LGSLFS
A0A1U7T4L4_BCL2L1-      --------------------------------------------LGSLFS
A0A1U7UZD8_BCL2L10      -------------------------GFCVFFSTPLPLTFWRRLPVQAFVS
A0A1U7UJF2_BCL2L2-      --------------------------------------------VGAFFA
A0A1U7UJF2_BCL2L2-      STTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYS
                                                                      :  :

A0A1U7T4L4_BCL2L1-      RK--------------
A0A1U7T4L4_BCL2L1-      RK--------------
A0A1U7UZD8_BCL2L10      CLLAMAFIYFFWTRLL
A0A1U7UJF2_BCL2L2-      SK--------------
A0A1U7UJF2_BCL2L2-      PY--------------
                                        

© 1998-2019