Dataset for protein BCL-2-like of organism Takifugu rubripes

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5K5B3_MCL1-01      MNIIANHTALRIMNVVFQNGVVDGAGHSSPLIPMASRGSLSGNDSPKRPS
A0A3B5KD08_BCL2L10      -----------------------------------MSCGLWKETLALAED
H2U5I3_BCL2L1-01        -----------------------MSYNNRELVEHFLRYKLSQRNYPTS--
H2U5I3_BCL2L1-02        -----------------------MSYNNRELVEHFLRYKLSQRNYPTS--
A0A3B5K6B9_BCL2L1-      ------------------------MSQNRELVIFYIKYKLSQRNYPFNHN
A0A3B5K6B9_BCL2L1-      ------------------------MSQNRELVIFYIKYKLSQRNYPFNHN
                                                               *     .    

A0A3B5K5B3_MCL1-01      KLSVIA-------------PKVCVAKAIQEDSQDTDHRSAPCTPEMNSVN
A0A3B5KD08_BCL2L10      YLSLCS------------------------------TSQCPAPPPPSESA
H2U5I3_BCL2L1-01        --LLRPEDTDGRTEGEKRSPGASNGLLVRSRNRG---GASP------SAG
H2U5I3_BCL2L1-02        --LLRPEDTDGRTEGEKRSPGASNGLLVRSRNRG---GASP------SAG
A0A3B5K6B9_BCL2L1-      GLILEP-------------PSRTDGQFVTTQFNGTFNGASPGTPPATSLA
A0A3B5K6B9_BCL2L1-      GLILEP-------------PSRTDGQFVTTQFNGTFNGASPGTPPATSLA
                           : .                                 .*      .  

A0A3B5K5B3_MCL1-01      GLDVSGRPAEDEAALDNDTRQLLSCFMADFCGIGSHQWRESGALSTMKRV
A0A3B5KD08_BCL2L10      T--------------------------------------------AMRHL
H2U5I3_BCL2L1-01        A-------------------------------------GIEAVNAALRDS
H2U5I3_BCL2L1-02        A-------------------------------------GIEAVNAALRDS
A0A3B5K6B9_BCL2L1-      T-------------------------------------SLDTVKEALRDT
A0A3B5K6B9_BCL2L1-      T-------------------------------------SLDTVKEALRDT
                                                                     ::.  

A0A3B5K5B3_MCL1-01      VANLMEKHRYVYNGMTKQLTLDDRGDDVSFVSSVAKSIFADGVTNWGRIA
A0A3B5KD08_BCL2L10      GQDMEKQHQARFNSLAQTFLRQCGPDLCSSLRKVMEELVGDGHLNWGRVV
H2U5I3_BCL2L1-01        AEEFEKLFAQAFSDLSSQ-LDITPDTAYQSFKNVMDEVFKDG-VNWGRVV
H2U5I3_BCL2L1-02        AEEFEKLFAQAFSDLSSQ-LDITPDTAYQSFKNVMDEVFKDG-VNWGRVV
A0A3B5K6B9_BCL2L1-      GNEFELRYTCAFSDLHNQ-LHITPATAYQSFENVMDEVFRDG-VNWGRIV
A0A3B5K6B9_BCL2L1-      GNEFELRYTCAFSDLHNQ-LHITPATAYQSFENVMDEVFRDG-VNWGRIV
                          ::   .   :..: .           . . .* ..:. **  ****:.

A0A3B5K5B3_MCL1-01      SLVAFGAVVAQHMKDNGRRDC----------------VEPVAQEISTYLL
A0A3B5KD08_BCL2L10      SLFTFTGVLARLMQEQKSTKPGLDPGQEQQLGQVPENCRGLAETIADYLG
H2U5I3_BCL2L1-01        GLFAFGGVLCVECVEKDASQL----------------VCRIADWMTIYLD
H2U5I3_BCL2L1-02        GLFAFGGVLCVECVEKDASQL----------------VCRIADWMTIYLD
A0A3B5K6B9_BCL2L1-      GLFAFGGALCVECVEKEMSPL----------------VGRIIEWMTVYLD
A0A3B5K6B9_BCL2L1-      GLFAFGGALCVECVEKEMSPL----------------VGRIIEWMTVYLD
                        .*.:* ..:.    ::                        : : :: ** 

A0A3B5K5B3_MCL1-01      TDRRDWLIKNNGWEGFVEFFQVSDPESSVRN-------MLMAVAGVAGLG
A0A3B5KD08_BCL2L10      EEKKDWLLENGGWEGFCKY---SLAAREVNHDSSMKTALFAAAGV--GLA
H2U5I3_BCL2L1-01        EHINPWIQSQGGWDCFAKIFGDDAAAEGRRARENLSRWMLGGLALLMGVL
H2U5I3_BCL2L1-02        EHINPWIQSQGGWDCFAKIFGDDAAAEGRRARENLSRWMLGGLALLMGVL
A0A3B5K6B9_BCL2L1-      NHIQPWIQSQGGWVRFAELFGQDAAAESRRSQERFRNGLLVGMSLAAGIA
A0A3B5K6B9_BCL2L1-      NHIQPWIQSQGGWVRFAELFGQDAAAESRRSQERFRNGLLVGMSLAAGIA
                           . *: .:.**  * :    . .    .        :: . .   *: 

A0A3B5K5B3_MCL1-01      ATLALLIR--
A0A3B5KD08_BCL2L10      GLTFLLVR--
H2U5I3_BCL2L1-01        VGAFIVKKH-
H2U5I3_BCL2L1-02        VGAFIVKKH-
A0A3B5K6B9_BCL2L1-      IGSFIVRKLL
A0A3B5K6B9_BCL2L1-      IGSFIVRKLL
                            :: .  

© 1998-2019