Dataset for protein Bcl-xL of organism Takifugu rubripes

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H2U5I3_BCL2L1-01        MSYNNRELVEHFLRYKLSQRNYPTS----LLRPEDTDGRTEGEKRSPGAS
H2U5I3_BCL2L1-02        MSYNNRELVEHFLRYKLSQRNYPTS----LLRPEDTDGRTEGEKRSPGAS
A0A3B5K6B9_BCL2L1-      -MSQNRELVIFYIKYKLSQRNYPFNHNGLILEP-------------PSRT
A0A3B5K6B9_BCL2L1-      -MSQNRELVIFYIKYKLSQRNYPFNHNGLILEP-------------PSRT
                           :***** .::.********* .    :* *             *. :

H2U5I3_BCL2L1-01        NGLLVRSRNRG---GASP------SAGAGIEAVNAALRDSAEEFEKLFAQ
H2U5I3_BCL2L1-02        NGLLVRSRNRG---GASP------SAGAGIEAVNAALRDSAEEFEKLFAQ
A0A3B5K6B9_BCL2L1-      DGQFVTTQFNGTFNGASPGTPPATSLATSLDTVKEALRDTGNEFELRYTC
A0A3B5K6B9_BCL2L1-      DGQFVTTQFNGTFNGASPGTPPATSLATSLDTVKEALRDTGNEFELRYTC
                        :* :* :. .*   ****      * .:.:::*: ****:.:***  :: 

H2U5I3_BCL2L1-01        AFSDLSSQLDITPDTAYQSFKNVMDEVFKDGVNWGRVVGLFAFGGVLCVE
H2U5I3_BCL2L1-02        AFSDLSSQLDITPDTAYQSFKNVMDEVFKDGVNWGRVVGLFAFGGVLCVE
A0A3B5K6B9_BCL2L1-      AFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVE
A0A3B5K6B9_BCL2L1-      AFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVE
                        ***** .** *** ******:*******.*******:********.****

H2U5I3_BCL2L1-01        CVEKDASQLVCRIADWMTIYLDEHINPWIQSQGGWDCFAKIFGDDAAAEG
H2U5I3_BCL2L1-02        CVEKDASQLVCRIADWMTIYLDEHINPWIQSQGGWDCFAKIFGDDAAAEG
A0A3B5K6B9_BCL2L1-      CVEKEMSPLVGRIIEWMTVYLDNHIQPWIQSQGGWVRFAELFGQDAAAES
A0A3B5K6B9_BCL2L1-      CVEKEMSPLVGRIIEWMTVYLDNHIQPWIQSQGGWVRFAELFGQDAAAES
                        ****: * ** ** :***:***:**:*********  **::**:*****.

H2U5I3_BCL2L1-01        RRARENLSRWMLGGLALLMGVLVGAFIVKKH-
H2U5I3_BCL2L1-02        RRARENLSRWMLGGLALLMGVLVGAFIVKKH-
A0A3B5K6B9_BCL2L1-      RRSQERFRNGLLVGMSLAAGIAIGSFIVRKLL
A0A3B5K6B9_BCL2L1-      RRSQERFRNGLLVGMSLAAGIAIGSFIVRKLL
                        **:.*.: . :* *::*  *: :*:***.*  

© 1998-2019