Dataset for protein BCL-2-like of organism Taeniopygia guttata

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H0ZCL9_BCL2A1-01      --METAEFYYVYYLAQDYLQYVLQE-------------------------
H0YUX3_BCL2-01        MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRASLPPDHSASAAAA
H0Z8G3_BCL2L1-01      ------MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEM
                                   :. .:: * *.:                         

H0ZCL9_BCL2A1-01      ------------------------------------SHLGPAQTRVAHVL
H0YUX3_BCL2-01        IAAAAIAAAGTSDHTGLVSPHPEPPGSATASHTPPAEGLRPAPQAVHLVL
H0Z8G3_BCL2L1-01      DGVLNGSPSWHAATSHIVN------GATVHQNSLEVHEIRRAAD-VRQAL
                                                            :  *   *  .*

H0ZCL9_BCL2A1-01      RTMASSLQDQTEEAVRPLLDRIDITSVAAAKRIFNGVMDEKFADGNTNWG
H0YUX3_BCL2-01        RQAGDEFSRRYQRDFSQMSGQLHLTPFTARSR-FVAVVEELFRDG-VNWG
H0Z8G3_BCL2L1-01      REAGDEFELRYRRAFSDLTSQLHITPSTAYQS-FEQVVNELFRDG-VNWG
                      *  ...:. .    .  : ..: :*. :* .  *  *::* * ** .***

H0ZCL9_BCL2A1-01      RIMTIFTFGGLLTKKLQEHGVQLTAEEKEQISYFITEYIINNKAEWIDAN
H0YUX3_BCL2-01        RIVAFFEFGGVMCVESVNREMFPLV---DNIATWMTEYLNRHLHNWIQDN
H0Z8G3_BCL2L1-01      RIVAFFSFGGALCVESVVKEMRVLV---KRIVSWMTTYLTDHLDPWIQEN
                      **:::* *** :  :   . :   .   ..*  ::* *:  :   **: *

H0ZCL9_BCL2A1-01      GGWENGFLTKFER----------------RSLLSFSKITALFIALVSLFR
H0YUX3_BCL2-01        GGWDA-FVELYGN---NMRPLFDFSWISLKTILSLVLVGACITLGAYLGH
H0Z8G3_BCL2L1-01      GGWER-FVDSMNDAAAEMRKGQEFN----KWLLTGATVAGVLLLGSLLSR
                      ***:  *:                     . :*:   : . :     * .

H0ZCL9_BCL2A1-01      EYY
H0YUX3_BCL2-01        K--
H0Z8G3_BCL2L1-01      K--
                      :  

© 1998-2019