Dataset for protein Mcl-1 of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q95KR3_MCL1-01      MFGLQRNAVIGLNLYCGGAGLGPGSGSS--------------------------------
K9IWB2_MCL1-03      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGG
K9IWB2_MCL1-02      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGG
K9IWB2_MCL1-01      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGG
                    ****************************                                

Q95KR3_MCL1-01      ------------------------------------------------------------
K9IWB2_MCL1-03      SAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAI
K9IWB2_MCL1-02      SAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAI
K9IWB2_MCL1-01      SAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAI
                                                                                

Q95KR3_MCL1-01      ------------------------------------------------------------
K9IWB2_MCL1-03      MSPEEELDGYEPEPLGKRPAVLPLLGLVEEASSGPGTDGSLPSTPPPAEEEEDELYRQSL
K9IWB2_MCL1-02      MSPEEELDGYEPEPLGKRPAVLPLLGLVEEASSGPGTDGSLPSTPPPAEEEEDELYRQSL
K9IWB2_MCL1-01      MSPEEELDGYEPEPLGKRPAVLPLLGLVEEASSGPGTDGSLPSTPPPAEEEEDELYRQSL
                                                                                

Q95KR3_MCL1-01      -----------------------------------------------AFQGMLRKLDIKN
K9IWB2_MCL1-03      EIISRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
K9IWB2_MCL1-02      EIISRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
K9IWB2_MCL1-01      EIISRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
                                                                   *************

Q95KR3_MCL1-01      EDDVKSLSRVMVHVLSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
K9IWB2_MCL1-03      EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
K9IWB2_MCL1-02      EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
K9IWB2_MCL1-01      EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
                    **************:*********************************************

Q95KR3_MCL1-01      RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
K9IWB2_MCL1-03      RTKRDWLVKQRGWDGFVEFFHVEDLEGGISNKIAF----------------
K9IWB2_MCL1-02      RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
K9IWB2_MCL1-01      RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                    ***************************** * :                  

© 1998-2019