Dataset for protein BCL-2-like of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q95KR3_MCL1-01          ---------------------MFGLQRNAVIGLNLYCGG--AGLG-----
C7F841_BCL2A1-02        --------------MTDDEFGYIHMLAQDYLKYVLQIPQ-----------
C7F841_BCL2A1-01        --------------MTDDEFGYIHMLAQDYLKYVLQIPQ-----------
F1RZB9_BCL2L10-01       --------------MADAFRERTARLLTDYLEYCAR--E-----------
A0A287APJ6_BCL2-03      ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEW--------
O77737_BCL2L1-01        ------------------MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEE
A0A287AW74_BCL2L2-      -------------MATPASAPDTRALVADFVGYKLRQKGYVCGAG-----
A0A3Q9B4M8_BCL2L2-      -------------MATPASAPDTRALVADFVGYKMRQKGYVCGAG-----
A0A287APJ6_BCL2-01      MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAI
A0A287AW74_BCL2L2-      -------------MATPASAPDTRALVADFVGYKLRQKGYVCGAG-----
K9IWB2_MCL1-03          ---------------------MFGLQRNAVIGLNLYCGG--AGLG-----
K9IWB2_MCL1-02          ---------------------MFGLQRNAVIGLNLYCGG--AGLG-----
K9IWB2_MCL1-01          ---------------------MFGLQRNAVIGLNLYCGG--AGLG-----
                                                                          

Q95KR3_MCL1-01          ----PGSGSSA---------------------------------------
C7F841_BCL2A1-02        ----PGSGPSKTSRVLRD--------------------------------
C7F841_BCL2A1-01        ----PGSGPSKTSRVLRD--------------------------------
F1RZB9_BCL2L10-01       ----PGTAARQPSSPEAA--------------------------------
A0A287APJ6_BCL2-03      DAGDAGAASPGAAPAPGIFSSQPGRTPAPARTSPPPTPTAPAATAAAAAA
O77737_BCL2L1-01        NRTEAPEGTESEAETPSAINGNPSWHLA-------DSPAVNGATGHSSSL
A0A287AW74_BCL2L2-      ----PGEGPAADPLHQ----------------------------------
A0A3Q9B4M8_BCL2L2-      ----PGEGPAADPLHQ----------------------------------
A0A287APJ6_BCL2-01      ECYKQGAFITLVARNE----------------------------------
A0A287AW74_BCL2L2-      ----PGEGPAADPLHQ----------------------------------
K9IWB2_MCL1-03          ----PGSGSSASAPGG----------------------------------
K9IWB2_MCL1-02          ----PGSGSSASAPGG----------------------------------
K9IWB2_MCL1-01          ----PGSGSSASAPGG----------------------------------
                                                                          

Q95KR3_MCL1-01          --------------------------------------------------
C7F841_BCL2A1-02        --------------VAFSVQNEVEKNLKPCLDNFDVVSIDTARII-----
C7F841_BCL2A1-01        --------------VAFSVQNEVEKNLKPCLDNFDVVSIDTARII-----
F1RZB9_BCL2L10-01       --------------VLRCVAAQIREYNVRTLSVYRGFRWNRVELV-----
A0A287APJ6_BCL2-03      AGPVLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTA-----
O77737_BCL2L1-01        DAREVIPMAAVKQ-ALREAGDEFELRYRRAFSDLTSQLHITPGTA-----
A0A287AW74_BCL2L2-      --------------AMRAAGDEFETRFRRTFSDLAAQLHVTPGSA-----
A0A3Q9B4M8_BCL2L2-      --------------AMRAAGDEFETRFRRTFSDLAAQLHVTPGSA-----
A0A287APJ6_BCL2-01      --------------DKLLQAKKEIEKHSINDKQVVLCISVDVSQD-----
A0A287AW74_BCL2L2-      --------------AMRAAGDEFETRFRRTFSDLAAQLHVTPGSA-----
K9IWB2_MCL1-03          --------------RLLATGKEATARQEVGGGEAGMVIGGSAGASPPSTP
K9IWB2_MCL1-02          --------------RLLATGKEATARQEVGGGEAGMVIGGSAGASPPSTP
K9IWB2_MCL1-01          --------------RLLATGKEATARQEVGGGEAGMVIGGSAGASPPSTP
                                                                          

Q95KR3_MCL1-01          ----------------------------FQGMLRKLDIKNE---------
C7F841_BCL2A1-02        ----FNQVMEKEFEDGIINWGRIVTIFAFEGILMKKLLRK---RIAPDV-
C7F841_BCL2A1-01        ----FNQVMEKEFEDGIINWGRIVTIFAFEGILMKKLLRK---RIAPDV-
F1RZB9_BCL2L10-01       ----AWMAQKLLASPRGPNWYRVASLLTFAGMLLERHPREACGRKKKEG-
A0A287APJ6_BCL2-03      --RGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS-------
O77737_BCL2L1-01        --YQSFEQVLNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ-------
A0A287AW74_BCL2L2-      --QQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEME-------
A0A3Q9B4M8_BCL2L2-      --QQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEME-------
A0A287APJ6_BCL2-01      ------YSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFERL
A0A287AW74_BCL2L2-      --QQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEME-------
K9IWB2_MCL1-03          APDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAI
K9IWB2_MCL1-02          APDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAI
K9IWB2_MCL1-01          APDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAI
                                                      .                   

Q95KR3_MCL1-01          --------------------------------------------------
C7F841_BCL2A1-02        -------------------------------------DTYKEISYFVAEF
C7F841_BCL2A1-01        -------------------------------------DTYKEISYFVAEF
F1RZB9_BCL2L10-01       -------------------------------------NVSRDCRLLVALL
A0A287APJ6_BCL2-03      -------------------------------------PLVDNIALWMTEY
O77737_BCL2L1-01        -------------------------------------VLVSRIATWMATY
A0A287AW74_BCL2L2-      -------------------------------------PLVGQVQEWMVTY
A0A3Q9B4M8_BCL2L2-      -------------------------------------PLVGQVPEWMVTY
A0A287APJ6_BCL2-01      MSVNYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSSSKF
A0A287AW74_BCL2L2-      -------------------------------------PLVGQVQEWMVTY
K9IWB2_MCL1-03          MSPEEELDGYEPEP---------------LGKRPAVLPLLGLVEE-----
K9IWB2_MCL1-02          MSPEEELDGYEPEP---------------LGKRPAVLPLLGLVEE-----
K9IWB2_MCL1-01          MSPEEELDGYEPEP---------------LGKRPAVLPLLGLVEE-----
                                                                          

Q95KR3_MCL1-01          --------------------------------------------------
C7F841_BCL2A1-02        ITKNTGQ---WIRQNGGWE-------------------------------
C7F841_BCL2A1-01        ITKNTGQ---WIRQNGGWE-------------------------------
F1RZB9_BCL2L10-01       CAQLSGQHRTWLLANGGWD-------------------------------
A0A287APJ6_BCL2-03      LNRHLHT---WIQDNGGWD-------------------------------
O77737_BCL2L1-01        LNDHLEP---WIQENGGWD-------------------------------
A0A287AW74_BCL2L2-      LETRLAD---WIHSSGGWA-------------------------------
A0A3Q9B4M8_BCL2L2-      LETRLAD---WIHSSGGWA-------------------------------
A0A287APJ6_BCL2-01      AIRGLAE---ALQMEVKPYNVYVTVAYPPDTDTP------------GFAE
A0A287AW74_BCL2L2-      LETRLAD---WIHSSGGWELEAIKARVREMEEEAEKL---------KELQ
K9IWB2_MCL1-03          ------------ASSGPGTDGSLPSTPPPAEEEEDELYRQSLEIISRYLR
K9IWB2_MCL1-02          ------------ASSGPGTDGSLPSTPPPAEEEEDELYRQSLEIISRYLR
K9IWB2_MCL1-01          ------------ASSGPGTDGSLPSTPPPAEEEEDELYRQSLEIISRYLR
                                                                          

Q95KR3_MCL1-01          --------------------------------------------------
C7F841_BCL2A1-02        --------------NGFVKKF-----------------------------
C7F841_BCL2A1-01        --------------NGFVKKF-----------------------------
F1RZB9_BCL2L10-01       -------GFCLFFQGSLQQTW-----------------------------
A0A287APJ6_BCL2-03      -------AFVELYGPSM---------------------------------
O77737_BCL2L1-01        -------TFVELYGNNAAAES-----------------------------
A0A287AW74_BCL2L2-      -------EFTALYGDGA-----LEEARRLREGNWASVRTVLTGA------
A0A3Q9B4M8_BCL2L2-      -------EFTALYGDGA-----LEEARRLREGNWASVRTVLTGA------
A0A287APJ6_BCL2-01      ENKTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSIGSDGYMLSS
A0A287AW74_BCL2L2-      NEVEKQMNMSPPPGNAGP------VIMSIEEKMEADARSIYVGNVDYGAT
K9IWB2_MCL1-03          EQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDI
K9IWB2_MCL1-02          EQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDI
K9IWB2_MCL1-01          EQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDI
                                                                          

Q95KR3_MCL1-01          --------DDVKSLSRVMVHVLSDGVTNW--GRIVTLISFGAFVAKHLKS
C7F841_BCL2A1-02        -------------------------------EPKSGWLTFVEVTGKICEM
C7F841_BCL2A1-01        -------------------------------EPKSGWLTFVEVTGKICEM
F1RZB9_BCL2L10-01       -------------------------------TRHMVWVFVSYCTAVV--L
A0A287APJ6_BCL2-03      ----------------------------------RPLFDFSWLSLKALLS
O77737_BCL2L1-01        -------------------------------RKGQERFN-RWF----LTG
A0A287AW74_BCL2L2-      -------------------------------VALGALVTVGAFFASK---
A0A3Q9B4M8_BCL2L2-      -------------------------------VALGALVTVGAFFASK---
A0A287APJ6_BCL2-01      LT------CGMAPVTSITEGLQQDAFVELYGPSMRPLFDFSWLSLKALLS
A0A287AW74_BCL2L2-      AEELEAHFHGCGSVNRVT--ILCDKFSGH--PKGFAYIEFS---------
K9IWB2_MCL1-03          KNE-----DDVKSLSRVMVHVFSDGVTNW--GRIVTLISFGAFVAKHLKS
K9IWB2_MCL1-02          KNE-----DDVKSLSRVMVHVFSDGVTNW--GRIVTLISFGAFVAKHLKS
K9IWB2_MCL1-01          KNE-----DDVKSLSRVMVHVFSDGVTNW--GRIVTLISFGAFVAKHLKS
                                                             .            

Q95KR3_MCL1-01          INQESCIEPLAESITDVLVRTKRDWLVKQRGW--------DGFVEFFHVE
C7F841_BCL2A1-02        LCLLKQYY------------------------------------------
C7F841_BCL2A1-01        LCLLKQYY------------------------------------------
F1RZB9_BCL2L10-01       LYLWRKLL------------------------------------------
A0A287APJ6_BCL2-03      LALVGACITLGAYLGHK---------------------------------
O77737_BCL2L1-01        MTLAGVVL-LGSLFSRK---------------------------------
A0A287AW74_BCL2L2-      --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
A0A287APJ6_BCL2-01      LALVGACITLGAYLGHK---------------------------------
A0A287AW74_BCL2L2-      -DKESVRTSLA--LDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRA
K9IWB2_MCL1-03          INQESCIEPLAESITDVLVRTKRDWLVKQRGW--------DGFVEFFHVE
K9IWB2_MCL1-02          INQESCIEPLAESITDVLVRTKRDWLVKQRGW--------DGFVEFFHVE
K9IWB2_MCL1-01          INQESCIEPLAESITDVLVRTKRDWLVKQRGW--------DGFVEFFHVE
                                                                          

Q95KR3_MCL1-01          DLEGGIRNVLLAFAGVAGVGAGLAYLIR----------
C7F841_BCL2A1-02        --------------------------------------
C7F841_BCL2A1-01        --------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------
A0A287APJ6_BCL2-03      --------------------------------------
O77737_BCL2L1-01        --------------------------------------
A0A287AW74_BCL2L2-      --------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------
A0A287APJ6_BCL2-01      --------------------------------------
A0A287AW74_BCL2L2-      RTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
K9IWB2_MCL1-03          DLEGGISNKIAF--------------------------
K9IWB2_MCL1-02          DLEGGIRNVLLAFAGVAGVGAGLAYLIR----------
K9IWB2_MCL1-01          DLEGGIRNVLLAFAGVAGVGAGLAYLIR----------
                                                              

© 1998-2019