Dataset for protein Bfl1 of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


C7F841_BCL2A1-02      MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEK
C7F841_BCL2A1-01      MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEK
                      **************************************************

C7F841_BCL2A1-02      NLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILM
C7F841_BCL2A1-01      NLKPCLDNFDVVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILM
                      **************************************************

C7F841_BCL2A1-02      KKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGWENGFVKKFEP
C7F841_BCL2A1-01      KKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGWENGFVKKFEP
                      **************************************************

C7F841_BCL2A1-02      KSGWLTFVEVTGKICEMLCLLKQYY
C7F841_BCL2A1-01      KSGWLTFVEVTGKICEMLCLLKQYY
                      *************************

© 1998-2019