Dataset for protein Bcl-2 of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287APJ6_BCL2-01      -MLLLAAAFLVAFVLLLYMVSPL--------------ISPKPLALPGAHV
A0A287APJ6_BCL2-03      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASPGAAPAPGIFS
                              :.:    ::: *:   *               ** . . ** . 

A0A287APJ6_BCL2-01      VVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKHSINDKQ
A0A287APJ6_BCL2-03      SQPGRTPAPARTSPPPTPTAPAATAAAAAAAGPVLSPVPPVVHLTLRQAG
                          .* :.. ..  .    .  *  : .*   . :*..   : : ::.:  

A0A287APJ6_BCL2-01      VVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEV
A0A287APJ6_BCL2-03      ----------------DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVE
                                        ::. .. . .:. :.  :: : ::  *.*  :  

A0A287APJ6_BCL2-01      STFERLMSVNYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTA
A0A287APJ6_BCL2-03      ELFRD--GVNW-------------------GRIVAFFEFGGVMCV-----
                        . *    .**:                   **** . . .* : :     

A0A287APJ6_BCL2-01      YSSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKPLET
A0A287APJ6_BCL2-03      ------------ESVNREMSPLVDNIAL----------------------
                                    *::: *:.*    :::                      

A0A287APJ6_BCL2-01      RLISETTSVCKPEQVAKQIVKDAIQGNFNSSIGSDGYMLSSLTCGMAPVT
A0A287APJ6_BCL2-03      ------------------WMTEYLNRHLHTWIQDNG--------------
                                           :.: :: :::: * .:*              

A0A287APJ6_BCL2-01      SITEGLQQDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLG
A0A287APJ6_BCL2-03      ------GWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLG
                               .******************************************

A0A287APJ6_BCL2-01      HK
A0A287APJ6_BCL2-03      HK
                        **

© 1998-2019