Dataset for protein BCL-2-like of organism Stegastes partitus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4ZKP6_MCL1-01      MNIIPTTKRTALMSCFILPQNGVVEGQMHYGSGDPSAQIPMASPLDSHNG
A0A3B4Z3X2_BCL2L1-      ----MSQNRELV--VYYI----------KYKLSQRNYPLNHMVLNEAPNR
A0A3B4Z3X2_BCL2L1-      ----MSQNRELV--VYYI----------KYKLSQRNYPLNHMVLNEAPNR
A0A3B5BBQ0_BCL2-01      --MANECNRNIV--EKYI----------CHKLSKRGYAWGFDDVRDEDAA
A0A3B4ZFS0_BCL2L10      MSCGLWKETLVVAEDYLS----------LCCTSPHSAPPP---PSESA--
A0A3B5B4X7_BCL2L1-      MEIMSYSNRELV--EFFI----------SYKLSQRNYPTSLLRPEDAAGR
                               :   :                    .  .         :    

A0A3B4ZKP6_MCL1-01      NVGSGATPKRPKNLGVSTTNGFAGKGLRQVSDSLEDSSLPCTPELQSDSE
A0A3B4Z3X2_BCL2L1-      TDGGEARLAEEQRTETHANGTFNGTS-------------PGTPPPSPRRL
A0A3B4Z3X2_BCL2L1-      TDGGEARLAEEQRTETHANGTFNGTS-------------PGTPPPSPRRL
A0A3B5BBQ0_BCL2-01      NNGSVVDPPPTLVRRCHEAST--GPD-------------NESDPHLCRRL
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      TEGDKTNSAASNGLLVNSRGG-----------------------------
                                                                          

A0A3B4ZKP6_MCL1-01      TDVSSCPAGDEVLENDTRQLISSFLKDFTGLSKPRWNEGKALSTMKRVVE
A0A3B4Z3X2_BCL2L1-      ASTATMDAVKEALRDTANEFELRYARAFSDLHS-----------------
A0A3B4Z3X2_BCL2L1-      ASTATMDAVKEALRDTANEFELRYARAFSDLHS-----------------
A0A3B5BBQ0_BCL2-01      PQSDPHAAIHRVLREAGDELERLYQPDFTEMSR-----------------
A0A3B4ZFS0_BCL2L10      ----------AAMRCLAQDMEKQHQARFHSLTQ-----------------
A0A3B5B4X7_BCL2L1-      -----IEAVKAALKDSADEFELLFTQAFSDLSS-----------------
                                   .:     ::   .   *  :                   

A0A3B4ZKP6_MCL1-01      DVLEKHRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSL
A0A3B4Z3X2_BCL2L1-      ---------------QLHITPATAY-QSFENVMDEVFRDG-VNWGRIVGL
A0A3B4Z3X2_BCL2L1-      ---------------QLHITPATAY-QSFENVMDEVFRDG-VNWGRIVGL
A0A3B5BBQ0_BCL2-01      ---------------QLYLTSTTAQ-RRFAEVIDELFRDG-VNWGRIIAF
A0A3B4ZFS0_BCL2L10      ---------------TFLRQPGPDLCSSLRRVMEELVGDGHLNWGRVVSL
A0A3B5B4X7_BCL2L1-      ---------------QLDITPDTAY-HSFKSVMDEVFKDG-VNWGRIVGL
                                        :           .  * ..:. *   ****: .:

A0A3B4ZKP6_MCL1-01      VAFGAVVCQYLKER--------------------GRENCVDLVSEEISTY
A0A3B4Z3X2_BCL2L1-      FAFGGALCVECVEK--------------------EMSPLVGRIVEWMTVY
A0A3B4Z3X2_BCL2L1-      FAFGGALCVECVEK--------------------EMSPLVGRIVEWMTVY
A0A3B5BBQ0_BCL2-01      FEFGGTVCVECAAKE-------------------EMTSQVDNIAEWMTEY
A0A3B4ZFS0_BCL2L10      FTFTGVLARQLQEQRDTKPGLEPGKRQELGQGPVNCRGLAETIAD----Y
A0A3B5B4X7_BCL2L1-      FCFGGVLCVECVDK--------------------NMNELVPRIADWMTMY
                        . * ..:.     .                         .  : :    *

A0A3B4ZKP6_MCL1-01      LLCDQRDWLVKNNSWDGFVEFF--------RVADPELTVRNTLMAFAGFA
A0A3B4Z3X2_BCL2L1-      LDNHIQDWIQSQGGWDRFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTG
A0A3B4Z3X2_BCL2L1-      LDNHIQDWIQSQGGWDRFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTG
A0A3B5BBQ0_BCL2-01      LNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAAS
A0A3B4ZFS0_BCL2L10      LGEEKKDWLLENDGWEGFVKF-----SLSAREVSQDLSMKTALFAAAGVG
A0A3B5B4X7_BCL2L1-      LDEHISLWIQSQGGWECFAEIFGQDAAAEARRSRDSLKRWLLVGGALLTG
                        *      *: .:..*: *.::              .:.    :      .

A0A3B4ZKP6_MCL1-01      GIGATLALLIRS
A0A3B4Z3X2_BCL2L1-      VVVGSLIAQKRL
A0A3B4Z3X2_BCL2L1-      VVVGSLIAQKRL
A0A3B5BBQ0_BCL2-01      LTIGAYLTQK--
A0A3B4ZFS0_BCL2L10      -LAGLTFLLVR-
A0A3B5B4X7_BCL2L1-      VLAGVLIAKKQ-
                           .        

© 1998-2019