Dataset for protein Bcl-xL of organism Stegastes partitus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4Z3X2_BCL2L1-      ----MSQNRELVVYYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLAEEQ
A0A3B4Z3X2_BCL2L1-      ----MSQNRELVVYYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLAEEQ
A0A3B5B4X7_BCL2L1-      MEIMSYSNRELVEFFISYKLSQRNYPTSLLRPEDAAGRTEG-------DK
                              .***** ::*.********* . :  ::*..**:*       ::

A0A3B4Z3X2_BCL2L1-      RTETHANGTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYA
A0A3B4Z3X2_BCL2L1-      RTETHANGTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYA
A0A3B5B4X7_BCL2L1-      TNSAASNGLLVNSRGG--------------IEAVKAALKDSADEFELLFT
                         ..: :** : .:  *              ::*** **.*:*:**** ::

A0A3B4Z3X2_BCL2L1-      RAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCV
A0A3B4Z3X2_BCL2L1-      RAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCV
A0A3B5B4X7_BCL2L1-      QAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCV
                        .***** *** *** ***:**:.******.************.***.***

A0A3B4Z3X2_BCL2L1-      ECVEKEMSPLVGRIVEWMTVYLDNHIQDWIQSQGGWDRFAEIFGQDAAAE
A0A3B4Z3X2_BCL2L1-      ECVEKEMSPLVGRIVEWMTVYLDNHIQDWIQSQGGWDRFAEIFGQDAAAE
A0A3B5B4X7_BCL2L1-      ECVDKNMNELVPRIADWMTMYLDEHISLWIQSQGGWECFAEIFGQDAAAE
                        ***:*:*. ** **.:***:***:**. ********: ************

A0A3B4Z3X2_BCL2L1-      SRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
A0A3B4Z3X2_BCL2L1-      SRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
A0A3B5B4X7_BCL2L1-      ARRSRDSLKRWLLVGGALLTGVLAGVLIAKKQ-
                        :***.:*:*.***** :::***:.* ***:*. 

© 1998-2019