Dataset for protein BCL-2-like of organism Seriola lalandi dorsalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4XKA5_MCL1-01      MNLIQAPKQAALTAVNYCICRQNGGLETWRDSSGDSSPEIAIGSTLCCDN
A0A3B4WGF4_BCL2L10      -MSCGLWKETRAVAEDYLFL------------------------------
A0A3B4YAG2_BCL2-01      ----MASEYNRNIVEKYICHKLSKRGYVWGFDDVRDEDAANNGSIV--AP
A0A3B4XS24_BCL2L1-      -----MSYSNRELVEFFISYKLSQSNCPTSLLRPEDAGGRTEGDKA----
A0A3B4XU17_BCL2L1-      ------MSQNRELVVFYIKYKLSQRNYPLTHMELNESPNRTDGGEAGLVE
                                     .  :                                 

A0A3B4XKA5_MCL1-01      GNVVPNDNSKRPKSLEVTSTNGYATKASREDSDVDDGSLPCTPEMQSDGE
A0A3B4WGF4_BCL2L10      ----------------------CCTSPQPAPPPPS---------------
A0A3B4YAG2_BCL2-01      PPTLVRRCREANTGPDNDSSPNLCRRLSQSDPHAE---------------
A0A3B4XS24_BCL2L1-      -------SSAASNGLLVNSSDRCGQPGTSSPPHGG---------------
A0A3B4XU17_BCL2L1-      EQRIATHANGTFNGTSPGTRPESPQRQQRLPSTTS---------------
                                                       .                  

A0A3B4XKA5_MCL1-01      TDVPSCPAGEVLESDTSQLISQSMKSFTGRSIQRRTEHRALQTMKRVVEG
A0A3B4WGF4_BCL2L10      ------------------------------------ESAA--AMRGMAQD
A0A3B4YAG2_BCL2-01      ------------------------------------IHRV---LREAGDE
A0A3B4XS24_BCL2L1-      ------------------------------------IEAVKSALKDSADE
A0A3B4XU17_BCL2L1-      ------------------------------------LDAVKEALRDSANE
                                                               .   :.   : 

A0A3B4XKA5_MCL1-01      VLEKHRYAYNGMINKLSLDNRGDDVRFVGAVAKSLFADGTTNWGRIASLV
A0A3B4WGF4_BCL2L10      METQHQARFHTLAQTFVTQCGLDPCSSLRKVMEELVGDGHLNWGRVVSIF
A0A3B4YAG2_BCL2-01      LERLYQPDFTEMSRQLYLTST-TAQRRFAEVIDELFRDG-VNWGRIIAFF
A0A3B4XS24_BCL2L1-      FELLFNQAFSDLSTQLDITPD-TAYHSFKSVMDELFKDG-VNWGRIVGLF
A0A3B4XU17_BCL2L1-      FELRYSRAFSDLHNQLHITPA-TAYQSFANVMDEVFRDG-FNWGRIIGLF
                        .   .   :  :   :           .  * ..:. **  ****: .:.

A0A3B4XKA5_MCL1-01      AFGVVVCQHMKDT-GRENCVE-----------SVGQEISKYLLSDQRDWL
A0A3B4WGF4_BCL2L10      TFTGVLARLLLEQNRVNPGLDPGQGQGLRNCRGLAETIADYLGEEKKDWL
A0A3B4YAG2_BCL2-01      EFGGTVCVECAAKEEMTSQVD-----------NIVEWMTEYLNGPLNSWI
A0A3B4XS24_BCL2L1-      AFGGVLCVECIQK-NMSELVS-----------RIADWMTMYLDEHISPWI
A0A3B4XU17_BCL2L1-      VFGGALCVECVEK-EMSPLVG-----------RIVEWMTVYLDNRIQPWI
                         *  .:.            :             : : :: **      *:

A0A3B4XKA5_MCL1-01      VKNNSWDGFVSFF-----RVADPESKVRNTLMAFAGFAGIGATLALLISA
A0A3B4WGF4_BCL2L10      LENGGWEGFCKF--SHSAREVSQDLSMKTALFAAAGVGLAGLTF--LLVR
A0A3B4YAG2_BCL2-01      KDNGGWDAFVELYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQ
A0A3B4XS24_BCL2L1-      QSQGGWDCFAEMFGQDAAAEARRSREAVRRWLLVGVAMLAGVLMGVLIVK
A0A3B4XU17_BCL2L1-      QSQGGWERFAEIFGQDAAADSRRSQESFKKWLLAGMTLVTGVVVGSLIAQ
                         .:..*: * .:           .       :  .     .  .   :  

A0A3B4XKA5_MCL1-01      MM-
A0A3B4WGF4_BCL2L10      ---
A0A3B4YAG2_BCL2-01      K--
A0A3B4XS24_BCL2L1-      KH-
A0A3B4XU17_BCL2L1-      KRL
                           

© 1998-2019