Dataset for protein Bcl-xL of organism Seriola lalandi dorsalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4XS24_BCL2L1-      MSYSNRELVEFFISYKLSQSNCPTSLLRPEDAGGRTEGDKA---------
A0A3B4XU17_BCL2L1-      -MSQNRELVVFYIKYKLSQRNYPLTHMELNESPNRTDGGEAGLVEEQRIA
                           .***** *:*.***** * * : :  ::: .**:*.:*         

A0A3B4XS24_BCL2L1-      --SSAASNGLLVNSSDRCGQPGTSSPPHGGIEAVKSALKDSADEFELLFN
A0A3B4XU17_BCL2L1-      THANGTFNGTSPGTRPESPQRQQRLPSTTSLDAVKEALRDSANEFELRYS
                          :..: **   .:   . *     *.  .::***.**.***:**** :.

A0A3B4XS24_BCL2L1-      QAFSDLSTQLDITPDTAYHSFKSVMDELFKDGVNWGRIVGLFAFGGVLCV
A0A3B4XU17_BCL2L1-      RAFSDLHNQLHITPATAYQSFANVMDEVFRDGFNWGRIIGLFVFGGALCV
                        .***** .** *** ***:** .****:*.**.*****:***.***.***

A0A3B4XS24_BCL2L1-      ECIQKNMSELVSRIADWMTMYLDEHISPWIQSQGGWDCFAEMFGQDAAAE
A0A3B4XU17_BCL2L1-      ECVEKEMSPLVGRIVEWMTVYLDNRIQPWIQSQGGWERFAEIFGQDAAAD
                        **::*:** **.**.:***:***:.*.*********: ***:*******:

A0A3B4XS24_BCL2L1-      ARRSREAVRRWLLVGVAMLAGVLMGVLIVKKH-
A0A3B4XU17_BCL2L1-      SRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
                        :***.*:...***.*:::::**::* **.:*. 

© 1998-2019