Dataset for protein Mcl-1 of organism Seriola dumerili

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4T8L9_MCL1-02      MNLIQSPKPTAFTAMNYCICRQNGGLETWTDGSGDSSPEIAIGSTICSHN
A0A3B4T8L9_MCL1-01      MNLIQSPKPTAFTAMNYCICRQNGGLETWTDGSGDSSPEIAIGSTICSHN
                        **************************************************

A0A3B4T8L9_MCL1-02      GNVVPNDNSKRPKSLEVTSTNGYATKASREDSDVDDGSLPCTPEIQSDGE
A0A3B4T8L9_MCL1-01      GNVVPNDNSKRPKSLEVTSTNGYATKASREDSDVDDGSLPCTPEIQSDGE
                        **************************************************

A0A3B4T8L9_MCL1-02      TDVPSCPAGDEVLEDDTRQLISQSMKSFTGRSIPRWTEHRALQTMKRVVD
A0A3B4T8L9_MCL1-01      TDVPSCPAGDEVLEDDTRQLISQSMKSFTGRSIPRWTEHRALQTMKRVVD
                        **************************************************

A0A3B4T8L9_MCL1-02      GVLEKHRYAYNGMINKLSLDNTGDDVRFVGAVAKSLFADGTTNWGRIASL
A0A3B4T8L9_MCL1-01      GVLEKHRYAYNGMINKLSLDNTGDDVRFVGAVAKSLFADGTTNWGRIASL
                        **************************************************

A0A3B4T8L9_MCL1-02      VAFGAVVCQRMKETGRENCVESVGQEISKYLLSDQRDWLVKNNSWDGFVA
A0A3B4T8L9_MCL1-01      VAFGAVVCQRMKETGRENCVESVGQEISKYLLSDQRDWLVKNNSWDGFVA
                        **************************************************

A0A3B4T8L9_MCL1-02      FFRVADPESKVRNTLMAFAGFAGIGATLALLIRCLFERSRPKQEGKIAFF
A0A3B4T8L9_MCL1-01      FFRVADPESKVRNTLMAFAGFAGIGATLALLISAMM--------------
                        ******************************** .::              

A0A3B4T8L9_MCL1-02      PMSCSREAHFHRAHS
A0A3B4T8L9_MCL1-01      ---------------
                                       

© 1998-2019