Dataset for protein BCL-2-like of organism Seriola dumerili

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4T8L9_MCL1-02      MNLIQSPKPTAFTAMNYCICRQNGGLETWTDGSGDSSPEIAIGSTICSHN
A0A3B4T8L9_MCL1-01      MNLIQSPKPTAFTAMNYCICRQNGGLETWTDGSGDSSPEIAIGSTICSHN
A0A3B4TIY6_BCL2L10      -MSCGLWKETRAVAEDYLYL------------------------------
A0A3B4TX71_BCL2-01      ----MASEYNRNIVEKYICHKLSKQGYVWGFDDVRDEDAANNGSIVA--P
A0A3B4V3T1_BCL2L1-      ------MSQNRELVVFYIKHKLSQRNYPLTHMELNESPNRTDGGEAGLVE
A0A3B4V9K8_BCL2L1-      -----MSYSNRELVEFFISYKLSQSNCPTSLLRPEDAGGRTEGDKAN---
                                 .   .  :                                 

A0A3B4T8L9_MCL1-02      GNVVPNDNSKRPKSLEVTSTNGYATKASREDSDVDDGSLPCTPEIQSDGE
A0A3B4T8L9_MCL1-01      GNVVPNDNSKRPKSLEVTSTNGYATKASREDSDVDDGSLPCTPEIQSDGE
A0A3B4TIY6_BCL2L10      ----------------------CCTSPQPAP-------------------
A0A3B4TX71_BCL2-01      PPTLVRRCREANTGPDNDSSPNLCRRLSQSD-------------------
A0A3B4V3T1_BCL2L1-      EQRIATHANGTFNGTSPGTRAESPQRQQRLP-------------------
A0A3B4V9K8_BCL2L1-      --------SAASNGLLVNSSDRCGQPGTSSP-------------------
                                                                          

A0A3B4T8L9_MCL1-02      TDVPSCPAGDEVLEDDTRQLISQSMKSFTGRSIPRWTEHRALQTMKRVVD
A0A3B4T8L9_MCL1-01      TDVPSCPAGDEVLEDDTRQLISQSMKSFTGRSIPRWTEHRALQTMKRVVD
A0A3B4TIY6_BCL2L10      ---------------------------------PPPSESAA--AMRSMAQ
A0A3B4TX71_BCL2-01      ---------------------------------PHAEIHRV---LREAGD
A0A3B4V3T1_BCL2L1-      ---------------------------------STTSLDAVKEALRDSAN
A0A3B4V9K8_BCL2L1-      ---------------------------------PHGGIEAVKSALKDSAD
                                                         .      .   :.   :

A0A3B4T8L9_MCL1-02      GVLEKHRYAYNGMINKLSLDNTGDDVRFVGAVAKSLFADGTTNWGRIASL
A0A3B4T8L9_MCL1-01      GVLEKHRYAYNGMINKLSLDNTGDDVRFVGAVAKSLFADGTTNWGRIASL
A0A3B4TIY6_BCL2L10      DMETQHQARFHTLAQTFVTQCGLDPCSSLRKVMEELVGDGHLNWGRVVSI
A0A3B4TX71_BCL2-01      ELERLYQPDFTEMSRQLYLTST-TAQRRFAEVIDELFRDG-VNWGRIIAF
A0A3B4V3T1_BCL2L1-      EFELRYSRAFSDLHNQLHITPA-TAYQSFANVMDEVFRDG-FNWGRIIGL
A0A3B4V9K8_BCL2L1-      EFELLFNQAFSDLSTQLDITPD-TAYHSFKSVMDELFKDG-VNWGRIVGL
                         .   .   :  :   :           .  * ..:. **  ****: .:

A0A3B4T8L9_MCL1-02      VAFGAVVCQRMKET-GRENCVE-----------SVGQEISKYLLSDQRDW
A0A3B4T8L9_MCL1-01      VAFGAVVCQRMKET-GRENCVE-----------SVGQEISKYLLSDQRDW
A0A3B4TIY6_BCL2L10      FTFTGVLARLLLEQNRVNPGLDPGQGQGLGNCRGLAETIADYLGEEKKDW
A0A3B4TX71_BCL2-01      FEFGGTVCVECAAKEEMTSQVD-----------NIVEWMTEYLNGPLNSW
A0A3B4V3T1_BCL2L1-      FVFGGALCVECVEK-EMSPLVG-----------RIVEWMTVYLDNRIQPW
A0A3B4V9K8_BCL2L1-      FAFGGVLCVECIQK-NMSELVS-----------RITDWMTMYLDEHISPW
                        . * ..:.            :             : : :: **      *

A0A3B4T8L9_MCL1-02      LVKNNSWDGFVAFFRVADPESKVRNTLMAFAGFAGIGATL--ALLIRCLF
A0A3B4T8L9_MCL1-01      LVKNNSWDGFVAFFRVADPESKVRNTLMAFAGFAGIGATL--ALLISAMM
A0A3B4TIY6_BCL2L10      LLENGGWEGFCKF---SHSAREVSQDLSMKTALFAAAGVGLAGLTF--LL
A0A3B4TX71_BCL2-01      IKDNGGWDAFVELYD-RQRESVFSCSWPSIKTVFGLAALGAASLTIGAYL
A0A3B4V3T1_BCL2L1-      IQSQGGWERFAEIFG-QDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLI
A0A3B4V9K8_BCL2L1-      IQSQGGWDCFAEMFG-QDAAAEARRSREAVMKWLLVGVAMLAGVLMGVLI
                        : .:..*: *  :                       .     .: .   :

A0A3B4T8L9_MCL1-02      ERSRPKQEGKIAFFPMSCSREAHFHRAHS
A0A3B4T8L9_MCL1-01      -----------------------------
A0A3B4TIY6_BCL2L10      VR---------------------------
A0A3B4TX71_BCL2-01      TQK--------------------------
A0A3B4V3T1_BCL2L1-      AQKRL------------------------
A0A3B4V9K8_BCL2L1-      VKKH-------------------------
                                                     

© 1998-2019