Dataset for protein Bcl-xL of organism Seriola dumerili

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4V3T1_BCL2L1-      -MSQNRELVVFYIKHKLSQRNYPLTHMELNESPNRTDGGEAGLVEEQRIA
A0A3B4V9K8_BCL2L1-      MSYSNRELVEFFISYKLSQSNCPTSLLRPEDAGGRTEGDKAN--------
                           .***** *:*.:**** * * : :  ::: .**:*.:*.        

A0A3B4V3T1_BCL2L1-      THANGTFNGTSPGTRAESPQRQQRLPSTTSLDAVKEALRDSANEFELRYS
A0A3B4V9K8_BCL2L1-      ---SAASNGLLVNSSDRCGQPGTSSPPHGGIEAVKSALKDSADEFELLFN
                           ..: **   .:   . *     *.  .::***.**.***:**** :.

A0A3B4V3T1_BCL2L1-      RAFSDLHNQLHITPATAYQSFANVMDEVFRDGFNWGRIIGLFVFGGALCV
A0A3B4V9K8_BCL2L1-      QAFSDLSTQLDITPDTAYHSFKSVMDELFKDGVNWGRIVGLFAFGGVLCV
                        .***** .** *** ***:** .****:*.**.*****:***.***.***

A0A3B4V3T1_BCL2L1-      ECVEKEMSPLVGRIVEWMTVYLDNRIQPWIQSQGGWERFAEIFGQDAAAE
A0A3B4V9K8_BCL2L1-      ECIQKNMSELVSRITDWMTMYLDEHISPWIQSQGGWDCFAEMFGQDAAAE
                        **::*:** **.**.:***:***:.*.*********: ***:********

A0A3B4V3T1_BCL2L1-      SRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3B4V9K8_BCL2L1-      ARRSREAVMKWLLVGVAMLAGVLMGVLIVKKH-
                        :***.*:. ****.*:::::**::* **.:*. 

© 1998-2019