Dataset for protein BCL-2-like of organism Scophthalmus maximus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2U9CJ81_MCL1-01      MNIIPSTKRAAFNVTTGVMGCLILPQNGVVEGAMHYGSGNSLPQIAVGSV
A0A2U9BIG9_BCL2L1-      ----------------------------------MSDSNRELVEFFIGYK
A0A2U9BY16_BCL2L1-      -----------------------------------MSQNKELVVFYIQYK
                                                            .....*  : :   

A0A2U9CJ81_MCL1-01      IDSRG---GNVGAGDAPKRPK--------NLQVSATKAYAAKSCREDGGG
A0A2U9BIG9_BCL2L1-      LSQRNYPTSLLRPEDAGGRTE------GDKANSAASNGLLVDGGNRC---
A0A2U9BY16_BCL2L1-      LSQRKYPLNHMGLNEPPNRTDRGEAGLGEEQQTAPHANGTLNGVNPGTPP
                        :..*    . :   :.  *..        : : :.      .. .     

A0A2U9CJ81_MCL1-01      GGDVGGGSLPSTPESDGEHDVSGCPAADEALDSFTRELISQFLRDYVART
A0A2U9BIG9_BCL2L1-      -GQLGTDPLPPDG---------GVGAVKEALRDSAHEFEQLF--------
A0A2U9BY16_BCL2L1-      ESPLRLQRLPSSP---------SLDAVKEALRDSANEFELRY--------
                         . :    **.           .  *..*** . :.*:   :        

A0A2U9CJ81_MCL1-01      DPRWTDSKALSTMKRVVDRLVEKHRYAYNGMMNRLSLDNRRDDVTFVGAV
A0A2U9BIG9_BCL2L1-      ------NQAFSDLSLQLDITPDTAYQSFKSVMD-----------------
A0A2U9BY16_BCL2L1-      ------ARAFSDLHNQLHITPATAYQSFESVMN-----------------
                               .*:* :   :     .   :::.:*:                 

A0A2U9CJ81_MCL1-01      ARSLFGDGNTNWGRVSSLVAFGAVVSQHLKETGRGNCVELVGQEISTYLL
A0A2U9BIG9_BCL2L1-      --EVFKDG-VNWGRIVGLFAFGGVLCVECVEKNRGELVARIADWMTMYLD
A0A2U9BY16_BCL2L1-      --EVFRDG-VNWGRIIGLFAFGGALSVECVEKEMSSLVGRIVEWMTVYLD
                          .:* ** .****: .*.***..:.    *.  .. *  : : :: ** 

A0A2U9CJ81_MCL1-01      TDQRDWLVKNNSWEGFVEFFRVADPETTMRNT-------LIGLAGFAGVG
A0A2U9BIG9_BCL2L1-      EHISPWIQSQGGWGCFAEIFGQGAGAEARRYRESVRRWLLVGVGMLTGVL
A0A2U9BY16_BCL2L1-      NNIQPWIQSQGGWEHFAEIFGQDAAAGSRRSQESFKKWLLAGMTLVTGVV
                             *: .:..*  *.*:*       : *         * *:  .:** 

A0A2U9CJ81_MCL1-01      ATLALLIR--
A0A2U9BIG9_BCL2L1-      IAMFIAKKQ-
A0A2U9BY16_BCL2L1-      VGSLIAQKRL
                            :  .  

© 1998-2019