Dataset for protein Bcl-xL of organism Scophthalmus maximus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2U9BIG9_BCL2L1-      MSDSNRELVEFFIGYKLSQRNYPTSLLRPEDAGGRTE------GDKANSA
A0A2U9BY16_BCL2L1-      -MSQNKELVVFYIQYKLSQRKYPLNHMGLNEPPNRTDRGEAGLGEEQQTA
                          ..*.*** *:* ******:** . :  ::. .**:      *:: ::*

A0A2U9BIG9_BCL2L1-      ASNGLLVDGGNRC----GQLGTDPLPPDGGVGAVKEALRDSAHEFEQLFN
A0A2U9BY16_BCL2L1-      PHANGTLNGVNPGTPPESPLRLQRLPSSPSLDAVKEALRDSANEFELRYA
                        .  .  ::* *      . *  : **.. .:.**********:***  : 

A0A2U9BIG9_BCL2L1-      QAFSDLSLQLDITPDTAYQSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCV
A0A2U9BY16_BCL2L1-      RAFSDLHNQLHITPATAYQSFESVMNEVFRDGVNWGRIIGLFAFGGALSV
                        .*****  ** *** ******:***:***.********:*******.*.*

A0A2U9BIG9_BCL2L1-      ECVEKNRGELVARIADWMTMYLDEHISPWIQSQGGWGCFAEIFGQGAGAE
A0A2U9BY16_BCL2L1-      ECVEKEMSSLVGRIVEWMTVYLDNNIQPWIQSQGGWEHFAEIFGQDAAAG
                        *****: ..**.**.:***:***::*.*********  *******.*.* 

A0A2U9BIG9_BCL2L1-      ARRYRESVRRWLLVGVGMLTGVLIAMFIAKKQ-
A0A2U9BY16_BCL2L1-      SRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
                        :** .**...***.*: ::***::. :**:*. 

© 1998-2019